KEGG   Fomitiporia mediterranea: FOMMEDRAFT_147971Help
Entry
FOMMEDRAFT_147971 CDS       T03132                                 

Definition
(RefSeq) NAD-binding protein
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00520  Amino sugar and nucleotide sugar metabolism
fme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FOMMEDRAFT_147971
Enzymes [BR:fme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     FOMMEDRAFT_147971
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD NAD_binding_4 RmlD_sub_bind
Motif
Other DBs
NCBI-GeneID: 18673351
NCBI-ProteinID: XP_007268741
JGI: Fomme1_147971
Position
Unknown
AA seq 459 aa AA seqDB search
MANNSSATDTALLYSMTASSRKILQTASSTLDKEGKEISTVGFSRFGFDCEVQLSALRAL
YLRPHYVNTSHTKPAANGSADVEQDIVKIDDDHGWFTGGDVDMYQSKSIFHPDTHSISYT
TLSRFPPVKLLTPSHRKRILVTGGAGFVGSHLVDRLMLLGHEVTVLDNFFTGSRTNVSHW
IGHPNFEMVRHDVVEPFMIECDQIYHLACPASPPHYQSNPVKTIKTSFIGTLNMLGLAKR
TKARFLISSTSEVYGDPEVHPQPETYWGNVNPIGVRACYDEGKRVAETLTYGFHHQDGVD
VRVARIFNTYGPRMNPADGRVVSNFIVQALRGEDLTVYGGGKQTRSFQYIHDLIDGLIAC
MNSDFNEPINIGNSEEFTIAQFADVVREVVEKVQKEDGVENAKRVGVRNLAMPKDDPQQR
KPDTTRAKEVLGWQPRWTVRMGLEEMVRYYKAKMAEGSL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaactccagtgcaacagacaccgctcttttgtactcaatgaccgccagttca
cggaaaatattacaaactgcatcctcgaccctcgacaaggagggaaaggaaatcagcact
gtcggcttctcgcgcttcggcttcgactgcgaggtccaacttagcgctctacgtgctcta
taccttcgcccccactatgtaaatacttcgcataccaagcctgctgccaatggctccgcc
gatgttgagcaagacatcgtcaagattgacgatgatcatggctggttcactggtggagac
gtggacatgtatcagtcaaagtctattttccatcctgatacgcattctatctcgtacact
actctcagccgattcccgcctgtgaagctccttacaccgtctcatcgcaagcggattctt
gttactggcggtgccggttttgtcggctctcatctggtggatcgactcatgctccttggc
catgaagtcactgtcctcgacaatttcttcactggttcacgcacgaacgtgagtcattgg
atcggccatcctaactttgagatggtccgtcatgatgtggttgagccgttcatgattgag
tgcgaccaaatttaccacctggcatgtcctgcctcgccacctcactatcagtcgaaccca
gtgaagacaatcaagacctcgttcattggcactctcaacatgctgggactcgccaagcga
acaaaggcacgcttcttgattagcagtacatcagaggtgtacggtgacccagaagttcac
ccacagccggagacttactgggggaacgtaaacccgatcggtgtacgggcttgctacgac
gagggaaagcgagttgctgagactttgacatatggattccaccaccaggacggtgtggac
gtccgagtagctaggattttcaatacttacggtccgcgaatgaatcctgcggatggacgc
gttgtgtcgaactttattgtccaggcacttcggggcgaagaccttaccgtctacggcggt
gggaagcaaacgcgctcgttccagtatattcacgatctgatcgacgggttgatcgcgtgc
atgaactcggactttaacgaacctattaacattggtaacagtgaagaattcacgattgct
cagtttgcggacgtcgtgcgcgaggttgtcgagaaggtacaaaaagaggatggtgtggag
aacgcaaagcgcgtcggagtacgtaacttggctatgccaaaggacgaccctcagcagcgc
aagccggatacgacgcgtgcgaaagaggtgcttggatggcagccacgctggactgttcgg
atgggccttgaggagatggtgcgctactataaggcaaagatggctgaaggcagcctctga

DBGET integrated database retrieval system