KEGG   Fomitiporia mediterranea: FOMMEDRAFT_152473Help
Entry
FOMMEDRAFT_152473 CDS       T03132                                 

Definition
(RefSeq) methionyl tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00450  Selenocompound metabolism
fme00970  Aminoacyl-tRNA biosynthesis
fme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    FOMMEDRAFT_152473
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FOMMEDRAFT_152473
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fme01007]
    FOMMEDRAFT_152473
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fme03016]
    FOMMEDRAFT_152473
Enzymes [BR:fme01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     FOMMEDRAFT_152473
Amino acid related enzymes [BR:fme01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   FOMMEDRAFT_152473
Transfer RNA biogenesis [BR:fme03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    FOMMEDRAFT_152473
 Prokaryotic type
   Other AARSs
    FOMMEDRAFT_152473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS tRNA-synt_1 Anticodon_1 zinc-ribbons_6 NPV_P10 C1_1 HypA
Motif
Other DBs
NCBI-GeneID: 18674025
NCBI-ProteinID: XP_007263379
JGI: Fomme1_152473
Position
Unknown
AA seq 702 aa AA seqDB search
MAQKIRSAEGLLRQVVPKGEPILPKDGEKNVLITSALPYCNNVPHLGNIIGSTLSADVFA
RYNRTRNRRTLYVCGTDEYGTATETQALKEGITPKELCDKYHLLHRATYDWFEIAFDHFG
RTTTPQHTEISQGIYKNLSKNGLLSKQTKEQTYCEGCQKFLADRFVEGTCPHCGADDARG
DQCDVCSRTLDAIELINPRCLVNKEHKVVARESAHMYVRLDSVQPRTEEWIKRSWKAGGW
SANAVINSDGVLVDARLKGGLRPSPVTRDLTWGVPVPDIEGADNQEMKGKVLYVWFDAPI
GYPSITANYTPEWEKWWFNPEHVRLYQFMGKDNVYFHTIFFPSIQLGDGRDWTLLHHLST
TEYLNYEGGKFSKSHNRGVFGPAAKETGIPVSVWRYYLLSSRPETQDAMFSWAECIAANN
NILLKNFGNFVNRVLTFVAKNYDGILPDGGDSEGPISPNGEHDADFVSDVNSLLQQYIDA
LESVKLRLGLHIIMQISSRGNLYLQSSGLGSALKDSSPKRCAQVLCRAVNLIYILSVLVE
PFMPATAKAILAQLNAPQRTVPEALGIDILPGHTLGKPAHLFKPIKEEMAETWRAQFAGT
KKDQTGNGPLPSEAAPAPALSKRKAAAAAKAAAKKNEEYTGPKTPEIVALETKIAAQGDL
VRTLKAEMPKTKEIDDELVAAVEELKKLKTDLAQEIKILQAA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggctcagaagattagatctgcagaaggtctcttgcgtcaggtcgtacctaagggtgaa
ccgatattgccaaaggacggcgagaaaaacgttcttatcacgtctgctttaccgtattgt
aataatgtaccacatcttgggaatatcatcggaagcacactgagtgctgacgtgttcgcg
agatacaatcgaacacgaaatcgacgtacactgtacgtttgtggtacggatgagtatggg
acggcaacggagacgcaagctttgaaggaagggatcacgccgaaagagctttgcgataag
tatcatttgttacatcgggcaacatacgattggtttgagatcgcatttgatcattttggg
agaacaacgacaccacagcatacagagatttcccaaggaatttacaagaatctgagcaag
aatggtcttctttcgaaacaaacgaaagagcaaacttattgtgaagggtgtcaaaaattc
cttgccgatcgtttcgtcgaaggaacttgtcctcattgcggagctgatgacgcacgagga
gatcaatgcgacgtctgcagtcgcaccctcgacgctatcgaactcatcaatccacgatgt
ctcgtcaacaaagagcacaaagtagtagctcgtgaatctgcgcacatgtatgtacggctc
gactcggtacaaccgcgcacggaggaatggataaaacgatcgtggaaagctggcggttgg
tcagcaaacgcggtgatcaacagtgatggcgtcttggttgatgctcgattgaagggtgga
ttacgaccgagccctgttacgcgagacttgacgtggggtgtgcccgttcccgatattgag
ggtgcggataaccaagaaatgaaggggaaagttttatacgtttggttcgatgcacccatt
ggatacccaagtatcaccgctaactataccccggaatgggaaaaatggtggttcaatcca
gaacatgttcgtttataccagttcatgggcaaggacaacgtatacttccataccatcttc
tttccgtcgattcaactaggagatggaagagactggacgttgctgcaccatctttccacc
acagagtaccttaactatgaaggcgggaagttttcgaagagccataatcgtggcgtcttt
gggcctgcagcgaaagagacgggaatccctgtgtctgtctggcgatactacctgttatct
tcacgacctgaaactcaggacgccatgttctcatgggcggaatgtattgccgcaaacaac
aacattctcttgaagaacttcggaaacttcgttaaccgagttctaactttcgtcgcgaag
aattatgatggcatccttcctgacggcggtgattcggaaggtcctatatcacccaatggt
gagcacgatgcggacttcgtttcggacgtcaacagtctcttgcaacaatacatcgacgca
ctagagtctgtaaagttacgtttgggcttgcacatcatcatgcaaatatcctctcgcggc
aacctttatctccaatcctccggtctaggttccgcgttgaaagactccagcccgaagcga
tgtgcccaggtactctgccgcgcagtgaatcttatctacatactttctgtgctcgtggaa
ccattcatgccggcaaccgccaaggccatcttggcgcagctcaacgcgccgcaacgtaca
gtaccagaggcacttggcattgatatcttacctggtcacacgctagggaagcctgctcat
ctgttcaaacccatcaaggaagagatggcagagacttggcgggcgcagtttgctgggacg
aagaaggaccagacggggaatgggccattgccctctgaggcggctccggctccggcactt
tcgaagcgtaaagctgcagccgcagcgaaagcagctgcgaagaagaatgaggagtatact
ggcccgaagacacctgagatcgtcgcgcttgagacgaagattgctgcccagggcgatcta
gttcggacactgaaggctgagatgccgaagacgaaggagatagacgacgaattagttgct
gccgtagaggagttgaagaaactcaagactgaccttgcacaagagataaagattttacaa
gcggcttga

DBGET integrated database retrieval system