KEGG   Fomitiporia mediterranea: FOMMEDRAFT_154311
Entry
FOMMEDRAFT_154311 CDS       T03132                                 

Definition
(RefSeq) ERG4/ERG24 ergosterol biosynthesis protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00100  Steroid biosynthesis
fme01100  Metabolic pathways
fme01110  Biosynthesis of secondary metabolites
Module
fme_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    FOMMEDRAFT_154311
Enzymes [BR:fme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     FOMMEDRAFT_154311
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 18674308
NCBI-ProteinID: XP_007264907
JGI: Fomme1_154311
Position
Unknown
AA seq 440 aa
MATSSSSKESANTLNPRTTSYEFCGPPGALAVSLGVPFLTYALYFSCSEAAGGCPPAPSV
LLDRLSAAVTDLNWWKSLWDTEAALMYLEWYAFCVATWALLPGDWIEGVTMRTGEKKKYK
INAFSTFLLSLGLAFGYIFTNGPKSFTFIYEKWTGFVTASVLMSVAQGLYVYISSFGEGK
LLALGGNSGNPIYDFYIGRELNPSIGSFDIKSFNELRPGLILWALIDISMLCEQAVRRGG
FANVTDSLYLVLLFQGLYIADGLYNEPAIFTTMDITTDGFGFMLAVGDLAWVPFVYSLQA
RYLVFHPVELGWFWCAAIVGVNLLGYYIFRDANGEKNDFRNGRNPKNLSYFQTERGTKLL
TSGWWGRSRHPNYFGDILMALAWSLPTGFDTPITYFYVTYFAVLLIHRQMRDDENCEKKY
GKDWETYKKLVPYRIIPYVY
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggccacgtcttcctcatcaaaagagagcgccaacacgctcaaccctcgcacaacatca
tacgaattctgtggtcctccaggcgcactcgcagtttctctaggcgttccattccttacc
tatgccttgtatttctcttgttcggaagctgcgggcggatgccctcctgctccttccgta
ctcctcgacagactcagcgctgctgtcactgacctcaactggtggaagagcctatgggat
acagaggccgcactcatgtacctcgaatggtacgctttctgcgtcgctacatgggccctc
cttcccggcgactggatagagggcgtaacgatgcgtacaggagagaagaaaaaatataaa
attaacgctttctcaacgttcttgctttctcttggtctcgcgtttggttatatctttacc
aacggtcctaaaagcttcacgtttatttacgaaaaatggactggattcgtcactgcttca
gtcttgatgtctgtagcgcagggcttatatgtctacatatcttcttttggcgaggggaaa
ctccttgcgttaggaggtaattccggaaatcccatctacgatttttacatcggtcgggaa
ttaaacccatccatcggctctttcgatatcaaatccttcaatgaactccgaccaggtcta
attctctgggcactcatcgacatcagcatgctctgcgaacaagccgtccgacgcggaggt
ttcgccaacgtcaccgactctctctacctcgtcctcctcttccaaggtctatacatcgca
gacggtttatacaacgaacccgccattttcacgacaatggatatcacgaccgatggattt
ggtttcatgcttgctgtaggcgacctcgcttgggttccatttgtttattccctacaagct
cggtacctcgtgttccaccccgttgagcttggatggttctggtgtgcggcgatcgttggt
gtgaacttgcttgggtattatatatttagggatgcgaatggagagaagaatgattttagg
aatggtcggaacccgaagaacctcagttacttccagacagaacgcggcaccaagctactc
acaagtggctggtggggccgctcgcgacacccgaattactttggcgacatactcatggcc
ctcgcatggtctctcccaacaggcttcgacacacccataacgtacttctacgtcacctac
tttgctgtcctactcattcatcgccagatgcgcgatgatgagaattgtgagaagaagtat
ggaaaggattgggagacgtataagaagttggtgccgtatcgtattataccttatgtgtat
taa

DBGET integrated database retrieval system