KEGG   Fomitiporia mediterranea: FOMMEDRAFT_156520Help
Entry
FOMMEDRAFT_156520 CDS       T03132                                 

Definition
(RefSeq) hypothetical protein
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
fme  Fomitiporia mediterranea
Brite
KEGG Orthology (KO) [BR:fme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fme01002]
    FOMMEDRAFT_156520
Enzymes [BR:fme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     FOMMEDRAFT_156520
Peptidases and inhibitors [BR:fme01002]
 Metallo peptidases
  Family M16: pitrilysin family
   FOMMEDRAFT_156520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16_C Peptidase_M16
Motif
Other DBs
NCBI-GeneID: 18674671
NCBI-ProteinID: XP_007266857
JGI: Fomme1_156520
Position
Unknown
AA seq 1117 aa AA seqDB search
MQDSKLNASIPVESDCVDWKFVPAKGDIEAYYVYVQPIKKRARDNGEYRLIRLENGLEAI
LVHDISIRTAAMNLSVATGHLHDPDDMPGLARLCEDALYAEFYESDIPVDYSEHDFTDLC
TKSSGSNTDFLLSTDPRTLRVVLEHFSENFRSPKFTLERLEDYIDEVDNSHHASHLNSDV
WRVSSVRNILACSGHPLRRFGCGNEELLKQSGWKSYRNSIARTSPKRKKLADDDALDSNA
AMVEIRKRLVGWWEKEYCARRMKLALIGKESLDELTHLIMKCSSSIPNRGKDPTPLLDQP
YGKEELGKIIHVRAKTDGAYAVTITFPVPWQTPLWRVKPFNFIGHLLRYGGPGSLKSHLR
KKGWLFEDVAEISARRYTAPGDFHSKLKRNGWLTDNILAYDVEVGRGVSLFEIRIELTMD
GFMNYREVISACFNYFDLLREPKGLSWVQEEIMRIDELSFRFGERPCEDDLVQNITDHMQ
CPIPRALVVLNPTLDWNEHLIHETLDRLVIENSLIMISGQDHTASEEMGPWLTDPWHGAE
YSEKKLSDDFVFSARSPNKIGELAFPQPNKFLPRNVDVQEVNVTHTSKGPTLIKRTSLTE
LWYKKGDRFWIPRAKIMVHAWSPFAGTTPRACVMNSIFSELVKDSLVEPTYDARCASFEY
EFYGDDFGLHLEFEGYSDKIHELVKLVLETIKRAEIKKDRIAAMIEKEEARLEPYLPELV
CDDCTEKFALLLKARFTSKEKRLALKEITTERLAKHVSLLLSQLKYTILVYGNVEKEDAF
CLASLVEETLGAKAAPGEKVTQYRTRRLPRPCNYIWEINSAEGSYISYYCQIDNCWDVRT
KAIVLLLSEILDEFVQSGNMTPIRDFLSTIRVLDVHDLGGLRIDFESRADPTYLESLTER
YLTQMRVWLQAMDESQFEWFRAEAMGRWTAGMEDDRFGDEADLFWKDIQSGYYRFDSLED
RMKLMRSVTKEEVVRMFDSFVHPASPTRSKLSIHIRPQNPLSPRLSPRASEAFADVLRGA
GITLDDDDELQWGWAWGPSVEEARNQWQGRYLEQLGGDEGKEAMLVEEFYRVVKKYPVEG
ERHAQLNPQAIYIKDVDRFRDSLGFFENSNLADTEME
NT seq 3354 nt NT seq  +upstreamnt  +downstreamnt
atgcaggactcgaagctgaacgcgagtatacctgtggaaagcgactgcgttgactggaaa
tttgttccagccaaaggcgatattgaagcatactacgtttacgtacagcctataaagaag
cgtgcgagagacaatggagaatatcgtttgatccgtctcgagaatggactcgaagccatc
ctcgtgcatgatataagtatccgtacagctgccatgaacttgagtgtcgccacaggacat
ctccatgatccggacgacatgcccggcctggcaaggttgtgcgaggatgcgctatatgcg
gaattttacgagagtgacattccggtagattactccgaacacgactttacagatttgtgt
accaaaagtagcggatcaaacacagatttcctcctttctacagatcccagaactctgaga
gttgtgctggaacatttctccgagaatttccgcagcccaaagtttaccttggagaggttg
gaggattacattgatgaggtggacaattctcatcatgcaagtcacctcaacagtgatgtc
tggagagtttcctcagtcaggaatatcctcgcatgttcaggtcatccgttacggaggttt
ggatgtgggaacgaggaattgttaaagcagtctggatggaagagttatagaaactcgatc
gcacgaacgagtcctaaaagaaagaaactcgctgatgacgatgcgttagactcaaatgcg
gcaatggtggaaataaggaagagattggtcggatggtgggagaaggaatattgcgcaagg
cgcatgaaattggcattgattggtaaagaatctctcgatgagctcacccacttgatcatg
aaatgctcttcatcaattccgaatcgtgggaaggaccctaccccacttctcgaccagccg
tacggaaaggaagagcttggcaaaatcatacatgttagggcgaaaactgatggcgcatat
gcagttacaatcacgtttcctgtaccctggcaaactcctctttggcgcgtgaagccattc
aatttcattggacacttacttcgctacggaggccccggatcgctgaaatcccatctacgg
aaaaaaggttggttattcgaagacgttgcagaaatatctgctcgtcggtataccgcgcct
ggcgactttcattccaaactaaaaagaaatggatggcttaccgacaatatacttgcttac
gatgtggaagttggacgaggagtctcattatttgagataaggatagaacttacgatggat
ggatttatgaattaccgcgaagtgatttcggcatgtttcaattactttgacctcctgcgc
gaacccaagggattgtcatgggtccaggaagaaattatgcggatcgatgaactctcattc
cggttcggcgagaggccgtgcgaagatgaccttgtacagaatattaccgaccacatgcag
tgtcctattcctcgagcacttgtcgtgttgaatccaacattggattggaatgaacatctc
attcatgagacacttgatcgtttagtcattgagaacagtttaattatgatctcgggacag
gatcatacggcgagcgaagagatggggccatggctcactgacccatggcatggcgctgag
tacagcgagaagaagcttagtgatgacttcgtcttctcagcccgaagtccaaataagatt
ggcgagcttgcgttcccacagccgaacaaattcctcccgaggaatgttgacgtccaggag
gtcaatgttacccataccagtaaaggcccgacactcatcaagcgtacttcactcacggag
ctgtggtataagaaaggtgaccggttctggatccctcgtgcgaaaattatggttcacgca
tggtcgcctttcgctggcacaactcctcgtgcatgcgtcatgaatagtatattctcggaa
cttgttaaagactcgctcgttgaaccaacgtatgatgcacgatgcgcatcgtttgagtac
gagttctacggagatgattttgggcttcatctcgagttcgaaggctactctgataaaata
cacgagcttgtaaagcttgtacttgagacgattaaacgagctgaaattaagaaggacagg
attgcagcgatgattgaaaaggaagaggctaggctcgagccatacttgcccgagctcgtt
tgtgatgattgcactgagaaatttgcattactactgaaggctcgtttcacgtcaaaagag
aagcgcctggcgctgaaagagataactaccgagcggttagctaaacacgtaagcctgcta
ttatcccagctgaagtacaccatccttgtctacggaaacgttgaaaaagaagacgctttt
tgtctcgcttccttggtggaagagacacttggagcaaaagctgccccaggggagaaggtc
acacaatatcgcacccgtcgtcttccgaggccgtgcaattatatatgggaaataaacagc
gcggaaggttcttatatctcatattattgtcaaatcgacaactgttgggacgtgcgtact
aaggcaatagtgttgctcttatccgaaattctcgatgaattcgtccaatccggaaatatg
acacctattcgcgacttcctgtctactatcagggtactcgatgtccatgatttgggaggg
ttgcgcatagacttcgaatcgagagctgaccctacgtaccttgagtcacttaccgaaagg
tatttgacgcagatgcgagtttggctccaggcgatggatgaatcccaattcgagtggttt
agagctgaagcaatgggtcgatggacggcagggatggaggatgacagatttggagatgag
gcagacctcttctggaaagatatccaatcgggttattatcgcttcgacagcctggaggat
agaatgaaactcatgaggagtgtgacgaaggaggaagtcgtcaggatgttcgatagcttc
gtccacccggcttctccgacgcgatcgaagctttcgatacacatccgtcctcagaatcct
ctttctccccgactgagtccgcgcgcgagcgaggcattcgccgatgtgttgcgtggtgcg
ggcatcaccctggatgacgacgacgagctccaatggggatgggcgtggggaccatccgta
gaagaagcacgcaaccaatggcagggaaggtatctcgagcagctgggaggcgatgaggga
aaggaagcaatgttagttgaagaattttatcgggttgtgaagaagtatcctgtggagggc
gagagacatgcacaattaaacccgcaggcgatatatatcaaggatgtggataggtttagg
gatagcctcggattcttcgagaattctaaccttgctgacaccgagatggagtag

DBGET integrated database retrieval system