KEGG   Fomitiporia mediterranea: FOMMEDRAFT_166672Help
Entry
FOMMEDRAFT_166672 CDS       T03132                                 

Definition
(RefSeq) Metallo-dependent hydrolase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00520  Amino sugar and nucleotide sugar metabolism
fme01100  Metabolic pathways
fme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FOMMEDRAFT_166672
Enzymes [BR:fme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     FOMMEDRAFT_166672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 18676527
NCBI-ProteinID: XP_007264721
JGI: Fomme1_166672
Position
Unknown
AA seq 540 aa AA seqDB search
MTTAIEDSQMNSGNGLVCFTNCLLAQEDGSLLEKDLWIDERRGVIVDAQRTFFLRKERPD
TVIDLGGNILRQVFLASKCLSKLTCLCCSPGLLDIQLNGAYGFDFSVYNGDDVVYRDGLD
MIARRIVETGVTSLLPTIITQECSLYPSLLRLLRPHSPVATPEYPYGGATLLGWHAEGPF
ISATKRGAHALPFLKDAAKGIADVETVYGADALAHHEDWVLSASSNADSVGVRMITLAPE
LPGILERGTDVIGTLTRRGVCIAIGHSVSGTDTAARAVRRGARMVTHLFNAMPQLHHRDP
GIIGLLGATPASLISSSETKSKPNEEGLISPSGTMSPTGTSFAGAIESVEAGGAEALDEN
DTPPHTPIFRSSPVQLSQSELSKLDVTQSDMKRPFYGMIVDGVHSHPNSVRLAYTAHKDG
CILVTDAMKILDPNMPDGTYDWRDGRRVVKEGVRLYIEGTDTLAGSVVTLDTCVRNFVRF
TGCTLGEALKCTTFNPAKCLRIENKKGTLRPEADADLVVLDKNGTVLSTWVRGRRVWTRS
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggctattgaagattcgcaaatgaattctggaaatggtcttgtatgcttcacg
aattgcttgcttgcacaggaggatggctccttgctagaaaaggatctttggatcgatgag
cgtcgcggtgtcatcgttgatgcccagaggactttcttccttcgcaaggaacggcccgat
acggtgatagacctcggaggaaatatccttaggcaagtgtttcttgcttcgaaatgtctt
tcgaaactaacgtgcctttgttgcagcccgggactcctcgatattcagcttaacggtgca
tatggctttgacttctccgtatataatggagatgacgttgtatatcgtgacggtcttgat
atgattgctcgacgtatcgttgagaccggagtcacttcattactcccgacgatcattact
caagaatgttccttatacccttcgctcttgcggctgcttcgtcctcatagccccgtagct
acaccggaatatccatacggcggtgccactttacttggctggcatgctgaaggtcctttc
atctctgccaccaaacgtggtgcacacgccctccccttcctcaaggacgcggcgaaggga
attgcagacgtcgaaacagtatatggcgccgacgcgctcgcccatcacgaggattgggtc
ctctcggcaagttcaaacgcggacagcgtcggtgtacggatgataacgctcgctcccgag
cttccagggattcttgagcgcggaacggacgtcataggtacattgacgagacgcggagta
tgcatcgctatcggccacagtgtatctggtacggatactgctgcccgtgcagtacgccgg
ggtgcgcggatggtgacgcatttattcaatgcgatgcctcagttgcaccatcgcgaccct
ggcatcattggtctgctaggtgcgactcctgcaagcctcatctccagttcggaaacgaaa
tccaagccgaatgaagaagggttaatttccccgagtggtacgatgagtccgactgggacg
agctttgctggtgccatcgaatccgtcgaagcaggtggtgcagaagcgcttgacgagaat
gatactccaccgcataccccaatattccgttcctctccagtgcaactgagccaaagcgaa
ctatcgaaattggatgtgactcaatcagacatgaagcgtccgttctatgggatgatcgtt
gatggagtgcattcgcaccctaactctgttcggttggcatacactgcacataaggacgga
tgcatcttggtgactgatgcaatgaagatcctggatccaaacatgccagacgggacatac
gattggcgcgatggacgacgtgtcgtcaaagaaggcgtcaggctttacattgagggcacc
gatactcttgccggaagcgttgtgacactcgacacttgcgtacgcaacttcgtccgcttc
acaggttgcacgctcggtgaagccctcaaatgtacaacattcaacccagccaagtgtctc
agaattgagaataagaaaggtacactccgacctgaggcagacgctgatctcgtcgtcctt
gacaagaatggtaccgtcttgagcacctgggtgcgtggacgtagggtctggacacgctcc
taa

DBGET integrated database retrieval system