KEGG   Fomitiporia mediterranea: FOMMEDRAFT_16715Help
Entry
FOMMEDRAFT_16715  CDS       T03132                                 

Definition
(RefSeq) hypothetical protein
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00051  Fructose and mannose metabolism
fme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    FOMMEDRAFT_16715
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fme04147]
    FOMMEDRAFT_16715
Enzymes [BR:fme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     FOMMEDRAFT_16715
Exosome [BR:fme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FOMMEDRAFT_16715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 18676615
NCBI-ProteinID: XP_007262249
JGI: Fomme1_16715
Position
Unknown
AA seq 490 aa AA seqDB search
MSKPNAQQSPAGGRMRPIRVIASGTVFLTHVLSLPTFPGEGTISRARNVTRLRGGSVANV
LTVLGQFSGVDALLVAPLAGNTEGAMLARDLQREGVNTRFCKVWEGASVPSAWIIEAEDS
SSRTIINHNPLPDITHEEFVSLLGPLLVPENYDLPISPLPSPTSPGSPQSSAPFDWLHFE
GRSVKTTLSNIIGIDGLARERKWRSQCVFSLDACKTRQGVEALIPHADVIFFSKQYALSQ
NAAYTTPRPFLLALASSGRVPPHALLIAYWGSAGAALLSVPSREYLQSSGWVDDEPRSTR
PLSTLSDATTGAALSDAGAHGVASVRSGSGFWAAGHRAGSGTSSSAFTAFSGSAQSSNIH
ESFGSSASAGMSDIPVVRAEDVDADADRDSQGTETGGGKREKDKRDESAAQDAFIAGMMY
ALSQRILPGPPYTPSSGLHPQYGAGILDVERGKWKLEDCLRFASELAGRRARRKDYNGLA
DEMRRAGWFD
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagccaaatgcacaacagtcgcccgctggcggtcgtatgagaccaatacgagtt
attgcatccggtactgtctttctaacgcatgtcttgtctctcccgacttttcctggtgaa
ggtacgatctcacgggcgcgaaacgttacacgattgcgaggaggaagcgttgccaatgtt
ctcaccgtccttgggcagttttctggcgtcgatgcattgctggtagcccctctagcagga
aatactgagggtgcaatgcttgcaagggacctgcagcgtgaaggagtgaatacccggttc
tgcaaggtttgggaaggtgcgagcgtaccaagcgcgtggataattgaagctgaagattcg
agctcacgaacaattatcaaccataatccattacctgacataacccacgaagaattcgtg
agcttactcggacccctactcgttccggaaaactacgatcttccaatatcaccgctccca
tcaccaacttctcctggaagtcctcagtcctcggctccatttgactggttgcattttgaa
ggccgctctgtgaaaacaactttatcgaatattattggtattgacgggcttgcgagggag
agaaaatggaggagtcagtgcgttttcagtctcgatgcttgcaaaacgaggcaaggagtt
gaagctcttattcctcacgcagacgtaatattcttttcgaaacaatatgcgctttcccaa
aacgctgcatacactactccacgaccttttctccttgctctcgcctcatccggacgagta
cctccgcatgctctactcatcgcttattggggttctgcgggtgctgcacttctcagcgtc
ccttctcgagaatatctccaatcaagcgggtgggtggacgacgaacctcgttcgactcgt
ccactcagtacgctcagcgacgctactactggcgctgcactttctgatgcgggagcacat
ggcgtagccagtgttcgtagcgggagtggattctgggcagccggacatcgagctggcagt
ggaacctcgagtagcgcgtttacagcgttctccggtagtgctcagagcagtaatatccac
gaaagcttcggttcatctgcgtcagctgggatgagcgatattccagtagtacgcgctgaa
gatgtcgatgcagatgcagatcgagactcccaaggaaccgagactggaggaggaaaacgc
gagaaagataagcgtgacgaatctgctgcgcaagatgcgttcatcgctgggatgatgtac
gctttgagtcagcgaattttacctggacctccgtatacgccttcttctggattacatcct
caatatggggctggtatattggacgtcgaacgaggaaagtggaaattagaagattgctta
agatttgcgagtgagcttgcaggtcgacgagcgcgacgaaaggattataatggacttgcg
gatgagatgagacgcgctgggtggttcgattaa

DBGET integrated database retrieval system