KEGG   Fomitiporia mediterranea: FOMMEDRAFT_78781Help
Entry
FOMMEDRAFT_78781  CDS       T03132                                 

Definition
(RefSeq) inositol phosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00010  Glycolysis / Gluconeogenesis
fme00030  Pentose phosphate pathway
fme00051  Fructose and mannose metabolism
fme00680  Methane metabolism
fme01100  Metabolic pathways
fme01110  Biosynthesis of secondary metabolites
fme01130  Biosynthesis of antibiotics
fme01200  Carbon metabolism
Module
fme_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FOMMEDRAFT_78781
   00030 Pentose phosphate pathway
    FOMMEDRAFT_78781
   00051 Fructose and mannose metabolism
    FOMMEDRAFT_78781
  09102 Energy metabolism
   00680 Methane metabolism
    FOMMEDRAFT_78781
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fme04147]
    FOMMEDRAFT_78781
Enzymes [BR:fme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     FOMMEDRAFT_78781
Exosome [BR:fme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FOMMEDRAFT_78781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-GeneID: 18679887
NCBI-ProteinID: XP_007264208
JGI: Fomme1_78781
Position
Unknown
AA seq 338 aa AA seqDB search
MAEEPPSTDIITLTRHILGEQLRLGAAATGDLTLLLTAIQTTSKFIATNVRKARLINLIG
LAGETNVSGDEQKKLDVLANDIMVNALRASRKTAVLVSEELDEAILIEERLRGRYCVVFD
PLDGSSNIDAGVNIGTIFGIYKVVSNSEKGDISDVLRPGREMVAAGYTMYGSSCNLVLST
GGGVNGYTLDTALGEFILTHPDIKIPARGKIYSFNEGNSTYFHPPVVNYLNSIKYPTNGK
SPYSSRYIGSMVADVHRTLLYGGIFGYPDDKKSKSGKLRLLYEAFPMAFLTEQAGGVATT
GRGRILDIEPKGIHERCAVFLGSKDDVNDLLKFYQDGK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggaaccgccgagcactgatatcatcaccctcacgcggcatatcctaggcgaa
cagctacgtcttggtgcagcagcgacgggtgacttgacgttgctccttactgctattcag
accacctccaagttcatcgctacgaatgtccgtaaggctcggcttatcaacttgattggc
ctagcaggcgagaccaacgtctccggcgacgaacaaaagaaactagacgtcctcgcaaac
gacatcatggtcaacgctctccgtgcctctcgcaaaacagctgtactcgtctcggaagag
ttggacgaggcgattttaattgaggagaggctgaggggacggtattgtgtggtgtttgac
cccttggatgggtcgagtaatattgatgctggtgtgaatattgggacgatttttgggatt
tataaagtcgtgagtaactcggagaagggagatatctcagacgtccttaggcctggacgg
gaaatggttgcggcagggtataccatgtacggttcgtcgtgcaacctcgttctctcgact
ggtggtggcgtgaatggatacacgctcgacaccgctctcggagagttcattctcacccat
ccagacattaaaatccccgcacgcgggaagatctactccttcaacgaaggcaactcaacc
tacttccacccacccgtcgtaaactacctcaactccatcaaataccccacaaacggcaag
tcaccctactcttctcgttacatcggttcgatggtcgcagacgtccaccgtacgcttctc
tacggcgggatcttcggctacccagatgataagaaaagtaagagcgggaagttgaggttg
ttgtatgaagcgttcccgatggcgtttttgacggagcaggctggaggggttgcgactacg
ggacggggaaggattttggatattgagccgaaggggatccatgagcggtgtgcggtgttt
ttggggagtaaggatgatgtgaatgatttgttgaagttttatcaggatggtaagtag

DBGET integrated database retrieval system