KEGG   Fomitiporia mediterranea: FOMMEDRAFT_83239Help
Entry
FOMMEDRAFT_83239  CDS       T03132                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00030  Pentose phosphate pathway
fme00480  Glutathione metabolism
fme01100  Metabolic pathways
fme01110  Biosynthesis of secondary metabolites
fme01130  Biosynthesis of antibiotics
fme01200  Carbon metabolism
Module
fme_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FOMMEDRAFT_83239
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FOMMEDRAFT_83239
Enzymes [BR:fme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     FOMMEDRAFT_83239
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     FOMMEDRAFT_83239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored
Motif
Other DBs
NCBI-GeneID: 18680120
NCBI-ProteinID: XP_007265610
JGI: Fomme1_83239
Position
Unknown
AA seq 496 aa AA seqDB search
MFSIPLAVCSGDIGLIGLAVMGQNLILNMNDKGFTVVAFNRTTSKVQHFLDNEAKGTKVV
GAFSIEELVAKLKKPRKIILLVKAGSAVDDFINALVPHLEQGDIIIDGGNSHYPDSDRRT
KYLASKGLQFIGCGVSGGEEGARHGPSLMPGGSPEAWPAIKPIFQAAAAQVEGVPCCDWM
GESGSGHFVKMVHNGIEYGDMQLIAEAYDILKRGLGLHEDEIASIFENWNKGVLDSFLIE
ITTNILRFKDDDGEPLVTKILDKAGQKGTGKWTAISALDYGTPVTLIGEAVFARCLSAIK
DERARASKIISGPQKETFRGDKQQFIDDLEQALYASKIISYAQGFMLMREAAKELKWNLN
YAGIARIWRGGCIIKSVFLNDITRAYEKTPNLESLLFDDFFNKAAHKAQPGWRRVIAQAV
LWGVPTPAFSTALAFFDGYRSDIVPANILQAQRDYFGAHTFKVLPGKENAKLKAGEDIHV
NWTGRGGNVSSSSYNA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaataccgcttgctgtctgcagtggcgacatcggtctcatcggcctcgctgtc
atgggtcaaaacctcattcttaacatgaatgacaagggattcaccgttgttgccttcaac
cgcacaaccagcaaagtccagcacttcctggataacgaagcaaaaggaacaaaggttgtc
ggcgcattctccatcgaggagcttgttgcaaagctcaagaaaccaaggaaaatcatcttg
ctcgtcaaggctggcagcgccgttgacgactttattaatgcgcttgtcccgcatcttgaa
caaggtgacatcataattgacggaggtaactctcactaccctgactccgaccgacgcaca
aagtacctcgcatcgaagggtcttcagtttatcggctgtggcgtttctggcggtgaggag
ggagctcgtcatggaccttccctcatgcccggtggttcgcctgaagcatggccagcaatc
aagcccattttccaggccgccgccgctcaagttgaaggcgtgccctgttgcgactggatg
ggggaaagcggttccgggcactttgttaagatggtccacaacggtatcgaatatggagac
atgcaactcattgcagaggcgtatgatatactgaagcgtgggctaggacttcacgaagac
gaaattgcatcaatctttgaaaattggaacaagggtgttctggattctttcttgattgaa
atcaccacaaatattcttcgcttcaaggatgatgatggcgagcccctcgtaaccaagatt
cttgacaaggccgggcaaaaggggacgggaaaatggactgccatatctgcccttgattat
ggtactccagtaactctcattggcgaggctgtctttgcccgctgtctctccgcaattaaa
gatgaacgtgctcgcgcaagcaagatcatttctggtcctcagaaagaaacattccgtggt
gacaaacagcagttcattgatgaccttgagcaagcactatacgcctctaagatcatttca
tatgctcagggcttcatgctcatgagggaagctgcgaaagagctcaaatggaatctgaac
tatgccggtattgctcggatttggcgaggagggtgcattattaaatctgtgttcctaaac
gatatcactcgggcatatgagaaaactcctaatctggaatctctcttgttcgatgatttc
ttcaacaaagctgctcacaaggctcagcctggttggagacgtgtgatcgcacaggctgtc
ctttggggcgtaccgaccccggccttcagcactgctcttgcattcttcgatggttataga
agtgacattgtacctgctaacattctgcaggctcagcgtgattactttggtgctcatact
ttcaaggttcttcctggcaaggagaacgcgaagttgaaggctggagaagacatccacgtc
aactggacgggccgtggtggcaatgtttcttcatcgagttacaatgcttaa

DBGET integrated database retrieval system