KEGG   Fomitiporia mediterranea: FOMMEDRAFT_88181Help
Entry
FOMMEDRAFT_88181  CDS       T03132                                 

Definition
(RefSeq) MTHFR-domain-containing protein
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00670  One carbon pool by folate
fme01100  Metabolic pathways
fme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    FOMMEDRAFT_88181
Enzymes [BR:fme01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     FOMMEDRAFT_88181
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 18680412
NCBI-ProteinID: XP_007267678
JGI: Fomme1_88181
Position
Unknown
AA seq 606 aa AA seqDB search
MKLSDKIAQHTSSRPFFTFEFFPPRTDEGFANLLTRVSRMSELDPLAVSVTWGAGGTTKD
RSLELAEIIQTEHAIDTLMHLTCTNMEQGLVDDVLRKAKERGIENILALRGDPPRGEEYW
IPIDPRFTHAIDLVKYIKSSPEFSSSFCIGVAAYPDGYVESDVDEDTELEYLKAKVDAGA
EFIITQLFYDVGGFLKWLRKVREKGINVPVIPGIMPLQNYATFLRLTKLCGTKVPSKLKL
DLEPLRHDDQKVKDYGVTLAMDIIRRLIDSGDVSGVHFCTLNLERSVRKVLEGLQWIGGP
PKHENRLIVDPADEIQEPPEFTIKPHDAAQTATDKLSTKPLPDIPEPGKGEVNNASTWDE
FPNGRFGDSKSPAFGLQLDPWNSGVPNSLGVSVTRWGNPKSPTDLTNLFLAHLHSKLSST
PFSPYPLLHESQLILKHLEDLTRRGWWTVFSQPAVDGVSSSDEVFGWGPAGGYVFQKGFV
EFFAVKEDVELLERKIRCRGDGWVDFFAANEKGELRTNVPESGRNAVTWGVFAGQEIAQS
TIIDRTSFLSWKEEAFSIWEQWSLVYPPDSAERRFLESVRSERWLVSIVHHDFKDSSKLW
SFILDE
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctcagataaaatcgcacaacatacctcttcccgtcctttcttcacttttgag
ttctttccaccgcgaacagatgagggcttcgccaatctcctcacgcgtgtttcgcgcatg
tccgagctcgatccgctcgccgtcagcgtaacctggggtgcaggaggcacaacaaaggat
aggagccttgagctcgccgagatcatccaaactgaacatgctatcgacacactcatgcat
ttaacatgcacgaatatggagcagggtctagttgacgacgttctaaggaaagctaaagaa
cggggaatcgaaaacatcttagctctacgaggagacccaccccgaggagaagagtactgg
atacccatagacccgcgtttcacacatgctattgatcttgtgaagtacatcaaatcctct
ccggaattttcttccagtttctgcataggagttgcagcttatcctgacggatatgtagag
tccgatgtggacgaagatacagaactggagtatctcaaagctaaggttgatgctggagct
gaattcatcataactcagctattctacgacgtcggtggcttcttaaaatggttaagaaaa
gtacgggagaaagggatcaatgttcccgtcatcccagggatcatgccgcttcaaaattac
gcaacctttctacgattaaccaaactctgtgggacgaaggttccgtcaaaactaaagctc
gatcttgagcctctacggcacgatgaccaaaaagtgaaggactatggcgtaacactcgca
atggacataatcaggcgactaatcgactccggggatgtcagtggtgttcacttctgtacg
ttaaacctcgagcggagcgtacgaaaggtgcttgaaggacttcaatggatcggaggccct
ccgaaacatgaaaatagactcatcgtcgacccagcagacgagatacaagaaccacccgag
ttcactataaagcctcacgatgcagcacaaactgctacagacaagttatcgacgaaacct
ctacctgacatacctgaaccgggtaaaggagaggttaacaacgcttcgacttgggatgag
ttcccgaatggacggtttggtgattctaagagtcctgcgttcggccttcaattggatcca
tggaactctggtgttccgaatagccttggcgtatcggtgacgcgatggggcaaccccaag
tctccaacagacctcacaaacctcttcctcgcacacttacactctaaactctcctccaca
ccgttctcaccctacccactcttacatgaatcgcaactcattctcaaacacctggaagat
ctgacacgtcgaggctggtggaccgtgttctcgcaacctgcagtagacggcgtgagttcc
tcagacgaggttttcggctggggacctgcgggtgggtatgttttccaaaagggattcgtc
gagttctttgcggtgaaggaggatgtggagttattggagaggaagataagatgtagaggt
gatggatgggtggatttctttgctgctaatgagaagggagaactgcgaacaaacgtccca
gaaagtggtaggaacgctgttacatggggtgtcttcgcaggacaagaaatcgcacagtca
acaattatcgacaggacttcgttcctctcctggaaggaggaagcattctcaatctgggaa
caatggtcgctcgtgtacccaccagactcagctgaacggaggttcctcgagtcagttcgt
agtgaaaggtggcttgtgagcatcgtacaccatgacttcaaagattcttccaagttgtgg
agcttcatattggatgaatag

DBGET integrated database retrieval system