KEGG   Fomitiporia mediterranea: FOMMEDRAFT_96760Help
Entry
FOMMEDRAFT_96760  CDS       T03132                                 

Definition
(RefSeq) GPI transamidase component GPI16
  KO
K05292  GPI-anchor transamidase subunit T
Organism
fme  Fomitiporia mediterranea
Pathway
fme00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
fme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    FOMMEDRAFT_96760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 18680892
NCBI-ProteinID: XP_007271280
JGI: Fomme1_96760
Position
Unknown
AA seq 543 aa AA seqDB search
MPPTSLLFLLLFTSLSFLCSNAAKESFNETLTVRPLRDGRVAARFLFTITQATSVPREPT
TLLDEDTPQHYSLLPLSLGQVLREYAVTEAHLSLNAGKWDYGRWGDPEDEAVASGAELWA
WMGDSDQMSVEDRWKGLRNAFSGLFCASMGSLDDLRTTSPSYAFRPDGDLPKLSSNQTHK
LRYASLPSENVCTENLTPFLKLLPCKSSAGIASLLNPHRLFDADWHGMSIHVSWSKQEGV
KLQMSVQSVFDPVRLSSQQKRDFSFQSLFHRSISEACPVATESKVEMTLPEDAGYLITPE
PLIVRENIAFYNIAKVHALPLDVSIRYPTENAFSYPALGTSVAPLSDILLTRTLSGTSQT
RGRLAVSIWNNRPHDLRLLYVETMPWLVTFYLHTLDLTVDGQKREDLMSLLSYTPPEAHG
RPTLLEAQLTVPAESKVELSMDVTKSFLRYTEHPPDAQRGWDLPPAIFIVGRNDSSKQSR
RIYSPAVLVDVATPDFSMPYNVIIMSSTLIALIFGSIFNLLTRRFVAIVVEDNGNAGSNR
QVN
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaacatctttgctgtttctcctattatttacttctctttcctttctttgtagt
aatgcagcaaaggaaagcttcaatgagactttgaccgtgcggcctcttcgagatggacgc
gtcgcagcccggttcttgttcaccattacccaggctacctcagttcctcgagaacccaca
acactcttagatgaagatactccgcagcattactcgcttctcccgctgtctttgggtcaa
gtacttcgagagtatgccgtgacagaagcacatctaagcctgaatgctggaaaatgggac
tatggcagatggggtgatccggaagatgaagcagttgcgagcggcgcagagttatgggca
tggatgggtgactctgaccagatgagcgtagaggatcggtggaaaggcctccgcaatgcg
ttctctggactgttctgtgcctcaatgggatctttagatgacttgcgaacaacatctcct
agttatgcctttcggccagatggcgaccttccaaaactctcctcgaaccaaacacacaaa
ctccgatatgcatcactaccttctgagaacgtttgcacggagaacttaacacctttcctc
aagttacttccatgcaagtcttctgcgggaatcgcatctctactcaatccgcatcgattg
ttcgatgcagactggcatggaatgagcatccatgtatcatggagcaaacaggaaggcgtc
aagctccagatgagtgtccaatctgtatttgatcctgttcgtctatctagtcaacaaaag
cgagatttctcgttccaatcgttgttccatcgttccatatcggaggcatgtcctgttgcg
acggaaagtaaggtcgaaatgactttacctgaagatgccgggtatttgatcacaccagag
ccgcttattgtgcgagaaaacattgccttctacaatattgcaaaagtccatgccttaccg
ctggacgtttccatccgatacccaacggaaaacgcattttcatacccagcattaggaacg
tccgtggctcctttgtctgatattcttctgacaaggacgttgagtggaacaagtcaaaca
cgagggcgattagctgtctcaatttggaacaatcgtcctcatgacctgcgattgctttac
gttgagacaatgccgtggctagttacgttctatcttcacacgcttgacctgacagtcgac
ggccagaagcgagaggatctgatgtcgcttttatcgtatacgccacctgaggcccatgga
cgacctacactccttgaagcacagctgaccgttcctgcagaatcaaaagtcgagttgtcg
atggacgtgacgaaatcgttcttgcgatatacagagcaccctccagatgcccagcgtgga
tgggacctgccgccagctatatttatagtaggcaggaacgactcgtcaaagcaaagtcga
cgaatatatagcccagcagtactcgtcgacgtcgcaactccggacttcagtatgccgtac
aacgtgattattatgagtagtaccttgattgcgctcatatttgggagtatcttcaacctc
cttacgcgtcgatttgtcgccatcgtcgttgaggacaatggaaacgcaggtagtaataga
caggttaactaa

DBGET integrated database retrieval system