KEGG   Fusobacterium mortiferum: C4N19_01390Help
Entry
C4N19_01390       CDS       T05444                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
fmo  Fusobacterium mortiferum
Pathway
fmo00260  Glycine, serine and threonine metabolism
fmo01100  Metabolic pathways
fmo01110  Biosynthesis of secondary metabolites
fmo01120  Microbial metabolism in diverse environments
fmo01130  Biosynthesis of antibiotics
fmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C4N19_01390
Enzymes [BR:fmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     C4N19_01390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 PHD_like
Motif
Other DBs
NCBI-ProteinID: AVQ17855
UniProt: C3WEZ4
Position
complement(277532..278563)
Genome map
AA seq 343 aa AA seqDB search
MVSFKNDYSEGVLPVIMEALLKTNLEQTVGYGEDEYTAKGIEAIKKAINFEDCYVRLLVG
GTQTNLLTISHILRPYEAVIAADTGHISVHEAGAIEATGHKVIELATNGDGKISLDMIKK
VYDVHKNDFHMVKPKMVYISNPTELGTLYTKEELINISNYCKEVGMYLYIDGARMASALA
SEKNDIELTDYPKYCDVFYIGGTKCGLLFGEALVITNKELAEGFFCSTKQKGATLAKGRL
LGIQFTELFQGDRYYQVGKHSNEMAAMLKKGVLEAGYKLKADSYTNQQFFILPNKVIDEI
GKKYRYEFWEKIDEETSAIRLVTSWATKEEDVKDFIEDLKNIK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggtaagttttaaaaatgattatagtgagggagtattaccagttataatggaggctctt
ttaaaaactaacttagaacaaacagtgggatatggagaggatgaatacacagctaagggt
atagaagctataaaaaaagctataaattttgaagattgctatgtacgtcttttagtagga
ggaacacagacaaatcttcttacaatttctcatattttacgtccatatgaagcagtaata
gcagcagatacagggcatatcagtgtacatgaagctggtgcaatagaagctactgggcat
aaagtaatagagttagcaactaatggtgatgggaaaataagtttagatatgataaaaaag
gtttatgatgttcataaaaatgattttcatatggtaaagcctaaaatggtatatatatct
aacccaacagaattaggaactctttatacaaaagaggagttaataaatatttctaactat
tgtaaagaggtaggtatgtatctatatattgatggagcaagaatggcatcagcactagct
tctgaaaaaaatgatatagagcttactgactatcctaaatattgtgatgttttctatata
ggaggaactaagtgtggacttttatttggagaggcattagtaattacaaataaagagcta
gctgaaggatttttctgtagtacaaaacaaaagggagctactttagcaaaaggaagatta
ttaggaatacaatttacagagttatttcaaggtgatagatactatcaagtaggaaaacac
tcaaatgagatggcagctatgttaaaaaaaggagtattagaggctggatataaattgaag
gcagattcatatactaaccaacaattctttatacttcctaataaggtgatagatgagatt
ggaaaaaaatatagatatgagttttgggaaaaaatagatgaagaaacttcagcaattaga
ttagtaacttcttgggctacaaaagaggaagatgtaaaagattttatagaagacttaaaa
aatataaaataa

DBGET integrated database retrieval system