KEGG   Fusobacterium mortiferum: C4N19_06305Help
Entry
C4N19_06305       CDS       T05444                                 

Definition
(GenBank) fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
fmo  Fusobacterium mortiferum
Pathway
fmo00051  Fructose and mannose metabolism
fmo01100  Metabolic pathways
fmo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C4N19_06305
Enzymes [BR:fmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     C4N19_06305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AVQ18720
UniProt: C3WAS6
Position
1274083..1274748
Genome map
AA seq 221 aa AA seqDB search
MLLEEERKEIIIYGKKMIQDSLTKGTGGNISIFVPDKNLMAITPSGIDYLKLNPEDIVIL
DVETGKVIEGERVPSSESDMHRIFYKYRKDLKAIVHTHSKYASGLSCTGQGLPAVHYLLA
VAGTEIPCAEYATYGTVKLAKNAYEAMKGTKAILLSNHGMLTGGKDLAEAYNIAENVEFC
CELYFISKVVGEPKILPKKEMEDMIERFKEYGKRSEEHEEI
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgttacttgaagaggaaagaaaagaaataataatttatgggaaaaaaatgatacaagat
tctcttacaaagggaactggaggaaatataagtatttttgtaccagataaaaatttgatg
gcaattactcctagtggaattgactatttaaaattaaatccagaagatatagtaatatta
gatgtagaaactggcaaagttattgaaggagaaagagtaccatcaagtgaaagtgatatg
catagaattttctataaatatagaaaagatttaaaagctatagtacatacacattctaaa
tatgctagtggtttatcttgtactggacaaggattaccagcagtacattatcttttggcg
gtagcaggaactgaaattccatgtgctgagtatgcaacatatggaacagtaaagttagca
aaaaatgcttatgaggcgatgaaaggaacaaaagcaatattattaagtaatcatggaatg
ttaactggaggaaaagatttagctgaagcttataatattgctgaaaatgttgaattttgc
tgtgaattatattttatttcaaaagtggtaggagaacctaaaatattacctaaaaaagag
atggaagatatgattgagagatttaaggaatatggaaaaaggagtgaagaacatgaagaa
atttaa

DBGET integrated database retrieval system