KEGG   Fusobacterium mortiferum: C4N19_10430Help
Entry
C4N19_10430       CDS       T05444                                 

Gene name
coaBC
Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
fmo  Fusobacterium mortiferum
Pathway
fmo00770  Pantothenate and CoA biosynthesis
fmo01100  Metabolic pathways
Module
fmo_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:fmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    C4N19_10430 (coaBC)
Enzymes [BR:fmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     C4N19_10430 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     C4N19_10430 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein Mur_ligase
Motif
Other DBs
NCBI-ProteinID: AVQ19483
UniProt: C3WE02
Position
complement(2083124..2084287)
Genome map
AA seq 387 aa AA seqDB search
MKNILIGVTGGISAYKSANIISKLKKKGYNVKVIMTENATKIITPLTLETLSRNRVYVDM
WDKNPHFEVEHISLADWADVVLVAPATYNIVGKVANGIADDMLSTVISACKKPVYFALAM
NVNMYENPILKDNIEKLKKYGYKFIEADEGFLACNVNAKGRLKDENEIIEIIEKDNIYRE
KVLTGKKILITAGRTEEAIDPIRYLSNRSSGQMGYALAKSAVDLGAEVVLISGPTNLEIP
TGVKEFVQVRSAQEMYDETIKRFSKMDIAIACAAVADYKPKYYSNEKIKKKDGELTIVLD
RNPDILLEMGKLKKEQILIGFAAETENLIENAIGKLERKNLDMIVANDASNMQKSTNEIY
IIKGKDSIKSLPEKKKEELAYDILMNI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatacttataggagttacaggaggaatttcagcatataagtctgctaatatt
atttcaaaattaaagaaaaagggatataatgtcaaagttattatgacagaaaatgctaca
aaaataattactccacttacattggaaactctttcaagaaatagagtgtatgtggatatg
tgggataaaaatccgcattttgaagtggaacatatctcattagcagattgggctgatgta
gtattagtagctccagctacatataatatagtaggaaaagtagctaatggaatagctgat
gatatgctgtcaactgtaatttcagcttgcaaaaagcctgtgtattttgctttggctatg
aatgtaaatatgtatgaaaatcctattttgaaagataatatagagaagttaaaaaaatat
ggatataaatttatagaagcagatgaaggatttttagcttgtaatgtaaatgcaaaggga
cgtttgaaagatgaaaatgagataatagagattatagaaaaagataatatctatagagaa
aaagttttaacaggaaaaaaaatccttataacagctgggagaacagaggaagcaatagac
ccaataagatatctttcaaatagatcaagtggacagatgggttatgctctagctaagtca
gctgttgatttgggagcagaggttgttcttatttctggaccaactaatttggaaatacca
acaggagtaaaggagtttgttcaagtaagaagtgctcaagagatgtatgatgaaactata
aaaagattttcaaaaatggatatagcaatagcttgtgcagcagtagctgattataaacct
aaatattattcaaatgaaaaaataaagaaaaaagatggggaactgacaatagtgttagat
agaaatccagatatactattagagatgggaaaattaaagaaagagcaaatattaataggg
tttgcagctgaaactgaaaatctaatagaaaatgcaataggaaaattagaaagaaaaaat
ttagatatgatagtagctaatgatgcaagcaatatgcaaaaatcaacaaatgaaatttac
ataattaaaggaaaagattctataaaatctcttccggaaaagaaaaaagaagagttagca
tatgatattcttatgaatatataa

DBGET integrated database retrieval system