KEGG   Fuerstia marisgermanicae: Fuma_00030Help
Entry
Fuma_00030        CDS       T04678                                 

Gene name
hemL
Definition
(GenBank) Glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
fmr  Fuerstia marisgermanicae
Pathway
fmr00860  Porphyrin and chlorophyll metabolism
fmr01100  Metabolic pathways
fmr01110  Biosynthesis of secondary metabolites
fmr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fmr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Fuma_00030 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fmr01007]
    Fuma_00030 (hemL)
Enzymes [BR:fmr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Fuma_00030 (hemL)
Amino acid related enzymes [BR:fmr01007]
 Aminotransferase (transaminase)
  Class III
   Fuma_00030 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: APZ90456
UniProt: A0A1P8W8S0
Position
complement(65254..66549)
Genome map
AA seq 431 aa AA seqDB search
MNDTANRPNSETEFARACKSIPGGVNSPARAFGAVGGTPPYIQRGDGPYLFDIDGNQYID
FIGSWGPHILGHRHPAVIRAIQLALETGTSFGAPTVAESELAELVVKLVPSVEKVRMVNS
GTEATMSAIRLARGFTGRDVIIKFAGCYHGHVDSLLVQAGSGALTLGTPSSPGVPSGCTA
DTLVLPYNDVAALGTAFEGKGAELAAVILEPVCGNMGCVVPTEEFLQALRQTCTNNGTVL
IFDEVMSGFRVALNCAQSRLGVTPDLTTLGKILGGGMPVGAYGGRADIMDAVSPVGSVYQ
AGTLSGNPVAMASGLATLQQLVKDDPYNKLESLAAQLEDGLLAAAKNANVPVQINRVGSM
LTMFFNEQPVTDFATATASDTDRFAKWFHGMLDRGVYLPCSQYEALFVSATHTPELIDET
LEAASATLATL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaccgcaaaccgcccgaatagcgaaaccgagttcgctcgcgcatgcaagtcc
attcccggcggcgtcaacagcccggctcgcgcatttggtgcggtcggcggaacgcctccg
tacattcagcgaggcgacggtccttacctgtttgatatcgatggcaatcagtacatcgat
tttatcgggtcgtgggggccgcacattttggggcatcgtcatccggctgtcattcgagcc
attcaactggctttagaaaccggcaccagctttggcgcgccgacggtggcggaatccgaa
ttggcagagctggttgtgaaactggttccgtcggtcgaaaaagttcgcatggtcaattcc
ggcacggaagccaccatgtcggccattcgcctggctcgcggcttcaccggacgtgacgtt
attatcaaattcgcaggctgctatcacggtcacgtcgacagcctgctggttcaggcgggc
agcggagctctaacgctgggcactccgtccagccccggcgtgccttccggctgcacagcc
gatactttggtgctgccgtacaatgacgtggcggcgctgggaacggctttcgaaggaaaa
ggggccgagcttgcggccgtaattctggagccggtctgcggcaacatgggctgcgttgtg
ccgaccgaagaattcctgcaggcgctgcgacaaacttgtaccaataatggcacggttctg
atttttgacgaagtgatgagcggctttcgagtggccctgaactgcgctcaaagccgcctg
ggtgtcacgccggatctgacgacgctcgggaaaattctcggcggtggcatgccggtcggc
gcgtatggtggtcgagccgacattatggacgctgtctccccagtcggcagcgtctatcag
gcaggaactctttccggcaacccggtcgcaatggccagcggcctggcgacgttgcagcag
cttgtcaaagacgatccctacaacaaattggaatcgctggccgctcagctggaagacggt
ctgctggcagccgcgaagaacgcgaatgtgcccgtgcagatcaatcgagtcggcagcatg
ctgacgatgttctttaacgaacagcccgtgactgattttgcaaccgcgacggcgtctgat
acggaccgctttgcgaagtggtttcatggaatgctggatcgaggcgtttatctgccatgc
agccagtacgaagctctgtttgtttcggcgacccatacgcctgagctgatcgacgaaacg
ctcgaagctgcctccgcgacgttggcaacgctgtag

DBGET integrated database retrieval system