KEGG   Fuerstia marisgermanicae: Fuma_04401Help
Entry
Fuma_04401        CDS       T04678                                 

Gene name
phoA
Definition
(GenBank) Alkaline phosphatase H precursor
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
fmr  Fuerstia marisgermanicae
Pathway
fmr00730  Thiamine metabolism
fmr00790  Folate biosynthesis
fmr01100  Metabolic pathways
fmr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fmr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Fuma_04401 (phoA)
   00790 Folate biosynthesis
    Fuma_04401 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Fuma_04401 (phoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fmr04147]
    Fuma_04401 (phoA)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fmr00537]
    Fuma_04401 (phoA)
Enzymes [BR:fmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Fuma_04401 (phoA)
Exosome [BR:fmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Fuma_04401 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fmr00537]
 Enzymes
  Fuma_04401 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Sulfatase Metalloenzyme Phosphodiest Ribosomal_S11
Motif
Other DBs
NCBI-ProteinID: APZ94762
UniProt: A0A1P8WL23
Position
complement(5884229..5885869)
Genome map
AA seq 546 aa AA seqDB search
MIRLRRTCVSILAVATLTTGNSLPSSQAADRIAELQAAAATSNKSDWGHWGPNPEKYSSW
TTHSNRLIPAYTFGIDLKAFAGENSVYRDEDGIKNLYGYLPEKTLNPKAEYFDQTDIYKL
QEAAVAAGKKRVILFVFDGMDWQTTRNAAIVKAGKVAYDEGRGEGLAFLDYRGAKTDFGY
FVTSPHNDGTAVNVDKQTVTTPGGKLRGGYDVTLGGEAPWSKVTDAQYPIGKSEITPHAY
TDSASSATSLMAGIKSYNAAINVDATGNGVLPIARTLQDDGFAIGVVTSVPISHATPACA
YANNVHRNDYQDITRDLIGRPSVFNPNGLPGVDVLMGGGWGIDQDKDGSQGKNFVPGNRY
ITDDDLAAIDVANGGKYVVAQRTSGEPGPEVLNAAVSQAKKQQQRLFGYFGVERGHLPYR
TADGNYDPVVNVGNPSSAKAEAYSKEDLRENVTLQQMALAAVDLLQSRSDCWWLMVESGD
VDWANHSNNIDSSIGAVISGDDAFRAVVKWIEENGGWDETALILTADHGHYFHLVQPEVL
VQKSAD
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtttgcgccgtacgtgcgtttccatcctcgccgtagccacgctgacgacaggc
aacagccttccttcgtcgcaggctgccgaccgcattgccgaattgcaggcggccgctgcc
acgtctaacaaatcagactggggccattgggggccgaatccagaaaagtactccagctgg
acgactcacagtaaccggctaatcccggcatatacattcggcatcgacctcaaggcgttt
gctggcgaaaacagtgtgtatcgcgatgaagatggcatcaagaatttgtatgggtatctg
cctgagaaaacgctgaacccgaaggcggagtacttcgaccagacggacatctacaaattg
caggaagctgccgtcgcggctggaaaaaaaagagtgatcctgtttgtgttcgatgggatg
gactggcaaacaactcgcaacgcagccatcgtcaaggcaggaaaggtggcgtatgacgaa
ggtcgtggcgaaggattggcttttctggattatcgaggtgcgaagacggatttcggttac
tttgtgacgagccctcacaacgacggaacggctgtcaatgtcgacaagcaaaccgtgacg
acgccgggcggaaagttgcgaggtggctatgacgtgacgcttggcggagaagcaccatgg
agcaaagtcacggacgcccaataccccatcggtaaaagcgaaattacgccgcatgcgtac
acggactcggcctcatcagccacatcacttatggcgggcatcaaatcttacaacgcggcg
attaacgtcgacgcgactggcaatggcgtgctgccaatcgcccgaacgctgcaggatgac
gggttcgcaatcggtgtggtgacgagtgtccccatcagtcacgccacgcctgcctgcgcg
tatgccaacaacgtgcatcggaacgattaccaggatatcacgcgcgacttgatcggtcgg
ccgtcagtgtttaacccgaacggcctaccgggagttgatgttttgatgggaggcggatgg
gggatcgaccaggacaaagatggatcgcagggaaagaatttcgtaccgggaaatcggtac
attacggatgacgacctcgctgccatcgatgttgcgaatggtggcaagtatgttgttgct
caacggaccagtggcgagcccggccctgaagtattgaacgcggccgtgtcgcaggcgaag
aagcagcagcagcggttgtttggctatttcggcgttgaacgagggcatctgccttatcgc
accgcggacggtaattacgaccccgttgtgaatgttggcaacccgtcgtccgccaaggca
gaagcctacagcaaagaagatttgcgcgagaacgtgacgctgcaacagatggctctggcc
gcggtcgacctgcttcagtcacgttctgattgctggtggttgatggttgaatcgggcgac
gtcgattgggcgaaccattccaacaacatcgacagctcaatcggtgccgtcatcagcggc
gatgatgccttccgtgcagtcgttaagtggattgaagaaaacggtggctgggacgaaacg
gctctgattttaaccgctgaccatggccactattttcacttggttcagccggaagtactc
gttcaaaaatccgccgattga

DBGET integrated database retrieval system