KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0088Help
Entry
OOM_0088          CDS       T02112                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
fna00740  Riboflavin metabolism
fna00790  Folate biosynthesis
fna01100  Metabolic pathways
fna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    OOM_0088
   00790 Folate biosynthesis
    OOM_0088
Enzymes [BR:fna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     OOM_0088
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     OOM_0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AFJ42652
UniProt: I2AWV5
Position
complement(82695..83906)
Genome map
AA seq 403 aa AA seqDB search
MFKQIKENIGNAIQALKQGKPVVVLDDYDRENEGDLILPGEKATEANIAFMLEYTSGIVC
LAMDSKKAKQLNLSPMVAANQNNSALTTSFTITIEAKEGVTTGVSAKDRAHTIQVASKTN
AKADELARPGHIFPLLANDKGVLGRNGHTEATVDLMKLSGFNSAGVLCELMNKDGTMMKA
PELEAFTKKYNLPLLTIAELYQYRLATEIFVTKMASSTIPFKKIGELEMSVYKDNFSDDE
VVVLSKPYTGNNPLVRMHSSCITGDIFGSLRCDCQDQLHKGIEMISEEGGFFIYLDQEGR
GIGLTNKLKAYNLQMNENMDTIEANLALGLPADARKYDLAVQVLKYNHVDQCRLISNNPE
KLAALRNVNIHAEPVYCEAFVNSHNRNYLITKKTKAKHTIKGI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagcaaataaaagaaaatattggaaatgcaatacaagctctcaagcaagggaag
cctgtggttgttcttgatgattacgatagagaaaatgagggagacttaattctcccaggt
gagaaagctacggaggctaatattgcttttatgcttgaatatacaagtggtattgtttgc
ttagcaatggattcaaaaaaagcaaaacagttaaatctgtcgccgatggtagcagctaat
caaaacaatagcgcgcttactacttcatttactataacgatagaggccaaagaaggtgta
actacaggagtatctgcgaaagatagagcacatacaatacaagtagcctcaaaaaccaat
gcaaaagctgatgaattagctagaccagggcacatattcccgcttttagcgaatgataaa
ggtgtacttggaagaaatggtcatactgaagcaactgttgatcttatgaagctcagtggc
ttcaatagtgctggtgttttatgtgagctgatgaacaaagatggcacaatgatgaaagct
cctgaattagaagcatttaccaaaaagtataacctgcctcttttaactattgctgaactt
tatcaataccgtttagcaactgaaatttttgtcacaaaaatggcaagctctacgatacca
tttaaaaagattggtgaattagaaatgagcgtctataaagataattttagtgatgatgag
gttgttgttttatctaagccttacactggtaataaccctctggttaggatgcactcatct
tgcataacaggggatatttttggatcactacgttgtgactgccaagaccagctacataaa
ggaatcgaaatgattagtgaagagggaggcttttttatataccttgatcaagaaggtaga
ggtataggcctgactaataagctcaaagcatataatctacagatgaatgaaaatatggat
actattgaagcaaatttagctcttggattacctgcagatgctagaaaatatgatttagcc
gtgcaagttctaaaatataatcatgtagatcagtgtagattgatatcaaataatcctgag
aaattagcagctcttagaaatgtcaacatacacgccgagcctgtatattgtgaagcattt
gtaaactcacataatagaaactacttaataaccaagaaaactaaagcaaaacatacaatt
aaagggatatag

DBGET integrated database retrieval system