KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0197Help
Entry
OOM_0197          CDS       T02112                                 

Definition
(GenBank) urease subunit alpha
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Urease_alpha Amidohydro_3 YjbE
Motif
Other DBs
NCBI-ProteinID: AFJ42754
UniProt: I2AX57
Position
complement(188390..189217)
Genome map
AA seq 275 aa AA seqDB search
MSQSPTAGNEVADLIITNAIVIDYTGIYKANIGVKNGKISAIGKSGNPNNCDGITNGLEI
GANTEILSAEGKIIIAGGIDSHIHFISPGQIDEALHSGITTMIGGGTGPNTGTNTTTCTP
GEFNIQKMIESVNDFPLNFDFMGKGNSSNYEALASQIKAGAMGLKLHEDWGSTPKAIDTC
LKVADDYDVQVAIHTDTLNESGFVENTINAFKGRTIRTFHSEGAGGSHAPDIIKVTGIEN
VLPSSTNPTLPYTKNTIEEHLDMLMVCHHLSANSF
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaagcccaacagctggaaatgaagtagctgatttaattattacaaatgctata
gtcatagattatacaggtatttacaaggccaatattggagtcaaaaatggaaaaatatcg
gctattggcaaaagtggtaatccaaataattgtgatggtatcacaaatggactagagata
ggcgctaatacggagattctctcagcagaaggcaagataataatagctggaggaatcgat
tctcatatccactttatttctcctggacaaattgatgaagcacttcatagtggcataaca
acaatgataggcggtggtacaggtccaaatactggaacaaacacaaccacttgtacccca
ggcgaattcaatatacaaaaaatgatcgaatcagtaaatgattttcctttgaactttgat
ttcatggggaaaggaaattctagtaattatgaagctttagcctcacaaataaaagcaggt
gcaatgggacttaaacttcatgaggactggggaagcacacccaaagctatagatacctgc
ttaaaagtggcagatgattatgatgtccaagtggctattcatactgatacgttaaatgaa
tctggttttgtagaaaatactataaatgcattcaaaggaagaactatccgtacttttcat
agtgaaggggctggtggcagtcatgctccagatatcataaaagtaactggaattgaaaat
gttttaccatctagtacaaatccaaccctaccatataccaaaaatacgatcgaagaacat
cttgatatgcttatggtttgtcatcatttaagcgccaacagcttctga

DBGET integrated database retrieval system