KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0568Help
Entry
OOM_0568          CDS       T02112                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
fna00020  Citrate cycle (TCA cycle)
fna00190  Oxidative phosphorylation
fna00650  Butanoate metabolism
fna01100  Metabolic pathways
fna01110  Biosynthesis of secondary metabolites
fna01120  Microbial metabolism in diverse environments
fna01130  Biosynthesis of antibiotics
fna01200  Carbon metabolism
Module
fna_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fna_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OOM_0568
   00650 Butanoate metabolism
    OOM_0568
  Energy metabolism
   00190 Oxidative phosphorylation
    OOM_0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DoxX
Motif
Other DBs
NCBI-ProteinID: AFJ43086
UniProt: I2AY39
Position
544330..544722
Genome map
AA seq 130 aa AA seqDB search
MAVISLTSSGIKDFFVQRVTAVVIAVYFGYLILQTLCLSHAGGLNYDSWRGLFTDSMFFR
VATLMAYLAMFFHAWVGIWIICGDYIKCAWASALIMLSFVLVYAFCFFWLFCGFIFLLRG
YFYEYSYARI
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaatatcattaacttcttctggaattaaagacttttttgtacagagagtgaca
gctgtagttattgctgtttattttggttatcttattcttcagactttgtgcttatctcat
gctggagggcttaactatgatagctggagaggattgttcacagatagtatgttttttaga
gttgctacattgatggcttatttggcgatgttttttcatgcttgggtaggtatttggatt
atttgtggtgactatattaagtgtgcttgggcatcagctcttattatgttgagctttgta
ttagtctatgcattctgctttttttggttattttgcggttttatttttctactaagaggt
tatttttatgagtatagctacgcaagaatttga

DBGET integrated database retrieval system