KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1080Help
Entry
OOM_1080          CDS       T02112                                 

Definition
(GenBank) glycogen branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
fna00500  Starch and sucrose metabolism
fna01100  Metabolic pathways
fna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OOM_1080
Enzymes [BR:fna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     OOM_1080
Exosome [BR:fna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OOM_1080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase AMPK1_CBM Sigma70_r1_1
Motif
Other DBs
NCBI-ProteinID: AFJ43522
UniProt: I2AZC5
Position
complement(1081888..1083810)
Genome map
AA seq 640 aa AA seqDB search
MKNVNSKQNNHSTIGEQDIHFFHEGKHIYAYEFMGAHKASENGIDGIRFTTWAPNAKSIC
VIGDFNHWQVEDKNYMKRITDAGLWSIFISDVKDGDKYKFVVTNKDTNHYVYKSDPYAFF
SELRPNTASVISTQTTYKWHDEKWLKKRATADYYNSPMNIYELHLASWKTKDNKFITYEE
IAEVLPKYVKDMGYTHVEFIPLHEHPLDASWGYQPTGFYSINSRHGDLVGLKHLIDKLHT
HDIGVILDWVPGHFCKDQHGLINFDGSACYEYQEPTKAINKGWGTHNFDLGRNEVKCFLI
SNAMYWINKFHIDGLRVDAVSNILYLNYDREDGQWVPNIHGEHENLEGIAFLRELNGVLK
HTCKGVITIAEESSSWPNISTPVEQGGLGFDFKWNMGWMNDTLRYISLDPVYRKYHHNLI
TFSIVYHYSEKFILSISHDEVVHGKKSLINKMWGDLWNKYAGLRLYLSFMIGHPGKKLIF
MGSEFGQFIEWREYEQLQWQVIDEYHTHRETLRFFKKLNEFYKAETALWECDYDHEGFQW
IDANNSKQSVLSFVRSNRGGKEKLIFVCNFTPVTYYDYHIGVPDAGSYIEAFNSDDLEFG
GSGQLIADEIFSTPESSHGFDKRITIKVPPMATLVLKLKK
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgtaaattcaaaacaaaataatcactctactattggcgagcaagatattcat
ttcttccacgaaggtaagcacatatatgcttatgagttcatgggtgctcacaaggcatct
gaaaatggaattgatggtattagatttacaacatgggctccaaatgcaaaaagtatttgt
gtgattggtgattttaaccactggcaagttgaagataaaaattatatgaaacgtatcacc
gatgctggactatggagcatatttatctcagatgtaaaagatggtgataaatataaattt
gtagtcacaaataaagatacaaatcattatgtatataaaagtgatccttatgcttttttc
tcagaattaagaccaaatactgcctctgtaataagtacacaaacaacatacaaatggcat
gatgagaaatggttaaaaaagcgtgctactgctgactactataatagcccaatgaacatc
tacgaacttcacttagcatcatggaaaactaaagataataagtttataacttatgaggaa
attgctgaagtattacccaaatatgtcaaggatatgggatacacgcatgttgagtttata
ccgctacatgagcatccactagatgcttcatggggttatcaaccaacaggtttttactca
attaatagtcgtcatggtgatttagtgggtttgaaacatctaattgataaacttcacact
catgatattggtgtaatcttagattgggtaccaggacatttctgcaaagatcagcatggt
ttgatcaactttgatggtagtgcatgttacgaataccaagagcctacaaaagctataaat
aaaggctgggggacacataattttgatctaggtagaaatgaggtcaaatgtttcttaata
tcaaatgccatgtactggatcaataaatttcatatcgatggtcttcgtgtcgatgcagta
tcgaatatcttatatctaaactatgatagagaagatggtcagtgggtacctaacattcat
ggtgaacatgaaaatttagaaggtattgctttcttaagagaactcaatggtgtcttaaaa
catacttgcaaaggagtaatcacaattgctgaagaatcatcatcttggccaaatatctcc
acacctgttgaacaaggtggtttaggatttgattttaaatggaatatgggttggatgaac
gatacactacgctacatttcattagatcctgtttatcgcaaatatcatcacaacttaatc
actttctccatagtgtatcattactcagaaaagtttattttgtctatctctcatgatgaa
gttgtacatggtaagaaatcattgataaataaaatgtggggcgatctgtggaataagtat
gcaggacttcgcttatacttatcatttatgattggacatccaggtaaaaaactcatattt
atgggtagtgaatttggtcaatttatcgaatggcgagagtatgagcagctacaatggcaa
gttattgatgaatatcatactcacagggagacattacgtttctttaagaaactaaatgaa
ttctataaagctgaaactgcgttatgggaatgtgattatgatcacgaaggcttccaatgg
attgatgcaaacaactctaaacaaagtgttttgtcttttgttagatcaaacaggggtggt
aaagaaaagctaatatttgtctgtaacttcactccagtaacatattacgactaccatata
ggtgttcctgatgcaggatcttatattgaagcatttaactctgatgatcttgaatttggt
ggttctggtcaacttattgccgatgaaatattttcaactcctgaatcatcgcatggtttt
gacaaaaggattacaataaaagtccctccaatggccactcttgttctcaaactcaaaaaa
taa

DBGET integrated database retrieval system