KEGG   Fusobacterium nucleatum subsp. animalis 7_1: FSDG_00804Help
Entry
FSDG_00804        CDS       T03612                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
fne  Fusobacterium nucleatum subsp. animalis 7_1
Pathway
fne00430  Taurine and hypotaurine metabolism
fne00620  Pyruvate metabolism
fne00640  Propanoate metabolism
fne00680  Methane metabolism
fne01100  Metabolic pathways
fne01120  Microbial metabolism in diverse environments
fne01200  Carbon metabolism
Module
fne_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:fne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FSDG_00804
   00640 Propanoate metabolism
    FSDG_00804
  09102 Energy metabolism
   00680 Methane metabolism
    FSDG_00804
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    FSDG_00804
Enzymes [BR:fne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     FSDG_00804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase SYCE1
Motif
Other DBs
NCBI-ProteinID: EEO42245
UniProt: A0A140PR70
Position
complement(807436..808632)
Genome map
AA seq 398 aa AA seqDB search
MKILVINCGSSSLKYQLINPETEEVFAKGLCERIGIDGSKMEYEVVAKDFEKKLETPMPS
HKEALELVISHLTDREIGVIGSVDEVDAIGHRVVHGGEEFAQSVLVNDEVLKAIEANNDL
APLHNPANLMGIRTCMELMPGKKNVAVFDTAFHQTMKPEAFIYPLPYEDYKELKVRKYGF
HGTSHLYVSGVMREIMGNPEHSKIIVCHLGNGASITAVKDGKSVDTSMGLTPLQGLMMGT
RCGDIDPAAVLFVKNKRGLTDAQMDERMNKKSGILGLFGKSSDCRDMENAVKEGDERAIL
AESVSMHRLRLYIGAYAAIMGGVDAICFTGGIGENSSMTREKALEGLEFLGIELDKEINS
VRKKGNVKLSKNISKVLIYKIPTNEELVIARDTFRLAK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatactagtaattaattgtggaagctcttcgcttaaatatcaattaataaatcct
gaaacagaggaggtttttgcaaaaggactttgtgaaagaattggaatagatggttctaag
atggaatacgaagttgtagcaaaagattttgaaaaaaagttggaaactcctatgccaagt
cacaaagaagcattagaattagtaatatctcatttaactgatagggaaataggagttata
ggttcagtagatgaagttgatgcaataggacatagagttgtacatggtggagaagaattt
gcacaatcagttttagtaaatgatgaagttttaaaagctattgaagctaataatgattta
gcccctttgcataatccagcaaatttaatgggaataagaacttgtatggaacttatgcct
ggtaagaaaaatgtggctgtatttgatactgccttccatcaaactatgaaaccagaagca
tttatatatccattaccatatgaggattataaagaattaaaagttagaaaatacggtttc
catggaacatctcatctatatgtatctggagttatgagggaaatcatgggaaatcctgaa
cattcaaaaataatagtatgtcacttaggaaatggtgcttcaataactgctgttaaagat
ggaaaatcagttgatacttcaatgggattaacacctttacaaggtttaatgatgggaaca
agatgtggagacatagacccagcagctgtattatttgttaaaaataaaagaggacttaca
gatgctcaaatggatgaaagaatgaataaaaaatctggaattcttggattatttggaaaa
tcttcagattgtagagatatggaaaatgcagttaaagaaggagatgaaagagcaatactt
gctgaaagtgtttctatgcatagattaagattatatataggagcttatgctgctattatg
ggtggagtggatgctatatgctttacaggaggaattggagaaaattcatcaatgactagg
gaaaaagcattagaaggtttagaatttttaggtattgaattagataaagaaattaattca
gttagaaaaaaaggaaatgtaaaattatctaaaaatatttcaaaagttttaatatataag
atacctacaaatgaagaattagtaatagcaagagatacttttagattggcaaaataa

DBGET integrated database retrieval system