KEGG   Fusobacterium nucleatum subsp. animalis 7_1: FSDG_00928Help
Entry
FSDG_00928        CDS       T03612                                 

Definition
(GenBank) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
fne  Fusobacterium nucleatum subsp. animalis 7_1
Pathway
fne00260  Glycine, serine and threonine metabolism
fne01100  Metabolic pathways
fne01110  Biosynthesis of secondary metabolites
fne01120  Microbial metabolism in diverse environments
fne01130  Biosynthesis of antibiotics
fne01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FSDG_00928
Enzymes [BR:fne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     FSDG_00928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: EEO42369
UniProt: A0A140PSA7
Position
complement(668829..669851)
Genome map
AA seq 340 aa AA seqDB search
MISFKNDYSEGACPEVLEALIKTNYEQTVGYGEDEYCKEARNLIKENINYPNADIYFLVG
GTQANTTVISHSLKPYEAVIACKTGHISIHETGAIEATGHKIIEVDGIDGKLTPNLILNE
LRKHEDHHMVKPKMVYISNTTEIGTVYTKSELESISKVCKENNLYLYLDGARLASALASE
KCDVNLEDYPKYCDVFYIGGTKCGLLFGEAVVIINDEIKKEFQFSVKQKGGLFAKGRLLG
IQFVTLFKDDLYYKIGVHSNKMALKIKNAFAEKGIKLATDSYTNQVFVDLNPEQIKKLEK
DVIFSVEFFGIGESQSSRFVTSWATKEEDVDRLVELIKNL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgataagttttaaaaatgattatagtgaaggagcttgtccagaagtattggaagcattg
ataaaaactaattatgaacaaacagtaggttatggagaagatgaatattgtaaagaagct
agaaatttaattaaagaaaatattaattatcctaatgcagatatttattttttagtagga
gggacacaggcaaatacaacagttatttctcactctctaaaaccttatgaagcagttatt
gcttgtaaaactgggcatatttctatacatgaaacaggagctattgaagcaacagggcat
aaaataattgaagtagatggtattgatggaaaattaactcctaatttaattttaaatgaa
ttaagaaaacatgaagatcatcatatggtaaagccaaaaatggtttatatctcaaataca
acagaaataggaactgtgtacactaaaagcgaattagaaagcatcagtaaagtttgtaaa
gaaaataatctatatttatatttagatggagcgagacttgcctcagcacttgcctctgaa
aaatgtgatgtaaatttagaagattatcctaaatattgtgatgttttctatataggtgga
acaaaatgtggattattatttggtgaagcagttgtgattataaatgatgaaataaaaaaa
gaatttcaattttctgttaaacagaaaggtggattatttgcaaaagggagattactagga
atacagtttgtaactttatttaaagatgatttatattataaaataggtgttcattcaaat
aaaatggcattaaaaataaaaaatgcttttgcagaaaagggaattaaactagctactgat
tcttatactaatcaagtttttgtagatttaaatccagagcaaataaaaaaattagaaaaa
gatgttattttttcagttgaattttttggaataggagaaagtcaatcatcaagattcgta
acttcttgggcaacaaaagaagaagatgttgatagacttgtggaactgataaaaaatctt
taa

DBGET integrated database retrieval system