KEGG   Fervidobacterium nodosum: Fnod_0760Help
Entry
Fnod_0760         CDS       T00579                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
fno  Fervidobacterium nodosum
Pathway
fno00430  Taurine and hypotaurine metabolism
fno00620  Pyruvate metabolism
fno00640  Propanoate metabolism
fno00680  Methane metabolism
fno01100  Metabolic pathways
fno01120  Microbial metabolism in diverse environments
fno01200  Carbon metabolism
Module
fno_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:fno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Fnod_0760
   00640 Propanoate metabolism
    Fnod_0760
  09102 Energy metabolism
   00680 Methane metabolism
    Fnod_0760
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Fnod_0760
Enzymes [BR:fno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Fnod_0760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK DSPc
Motif
Other DBs
NCBI-ProteinID: ABS60613
UniProt: A7HL30
Position
complement(833103..834323)
Genome map
AA seq 406 aa AA seqDB search
MRVLVVNCGSSSIKYQFLDMDTEQVLCKGLAERIGIPGSRIVHKKDDQKVVVEKPMKDHE
DALKYVLELVVDEKVGGVKDLKEIDAVGHRVVHGGEKFSGSVLIDEEVMRALEEYSYLAP
LHNPPNIMGIRAMMKLLPGVPNVAVFDTAFHSKMPAKAYLYAIPYEYYKKYKIRRYGFHG
TSHRYVSKRTAEILGLDYHKSKIITVHLGNGASIAAVMNGHSIDTSMGFTPLEGLVMGTR
SGDIDPSIVTFLMEKEGLTAEEVYTILNKKSGVLGLTDGFSSDMRDIEGKALEGDPVCRL
ALDIYEYRIAKYIGAYIAAMNGVDAIAFTAGVGENSPITRKEICENYLSYLGIKIDDEKN
NVKGEERIITTPDSKVKVLLVPTNEELMIARDTKEIIEKGLKQLEY
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagtactggtagtaaactgtggtagctcatcgattaagtatcaatttcttgatatg
gacacagaacaagtactttgtaaaggacttgctgaaaggataggtataccaggtagtaga
atagtacacaaaaaagacgaccaaaaagtcgttgtggaaaagcccatgaaggaccatgaa
gatgctcttaaatatgttttggaattagtagttgatgagaaagttggaggagtaaaagac
ttaaaagagattgatgccgttggtcacagggtagtgcacggtggagaaaaattttcaggt
tctgtattgatagatgaagaggttatgagagcacttgaagaatattcataccttgctcca
cttcacaatccaccaaatataatgggtataagggcaatgatgaaacttttaccaggggta
cctaacgtagctgtctttgatacagcattccactcaaagatgccagcgaaggcttacctt
tacgctataccatacgaatattacaaaaaatataaaattagaagatacggcttccacggt
acaagccacagatatgtctctaaacgtacagccgagatacttggacttgactatcacaaa
tcaaagataattacggtccatcttgggaatggagcttccattgctgcggtaatgaacgga
cacagtatagacacatcaatgggctttacaccacttgaagggcttgtcatggggacacgt
tcaggtgatattgacccatctatagttacattccttatggaaaaagaaggactaacggca
gaagaagtatatacaattcttaataagaaaagtggtgtactaggtcttacagatggcttc
agctcagatatgagagatatagaaggtaaagcacttgaaggtgatccagtttgcagattg
gctcttgatatatacgaatacagaattgcaaaatacataggcgcttatattgcggcgatg
aatggtgttgacgcaattgcatttactgcgggagttggtgaaaattccccgataacaaga
aaagaaatttgtgaaaactatctctcttatcttggtataaagatagatgatgaaaagaac
aacgtaaaaggcgaggaaagaataataacgacacctgactcaaaggtaaaggtattactc
gttccaacaaacgaagaattgatgatagcaagagatacaaaagaaattatcgaaaaaggc
cttaaacaacttgaatattaa

DBGET integrated database retrieval system