KEGG   Fervidobacterium nodosum: Fnod_0864Help
Entry
Fnod_0864         CDS       T00579                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
fno  Fervidobacterium nodosum
Pathway
fno00010  Glycolysis / Gluconeogenesis
fno00020  Citrate cycle (TCA cycle)
fno00620  Pyruvate metabolism
fno00640  Propanoate metabolism
fno00650  Butanoate metabolism
fno00680  Methane metabolism
fno01100  Metabolic pathways
fno01120  Microbial metabolism in diverse environments
fno01130  Biosynthesis of antibiotics
fno01200  Carbon metabolism
Module
fno_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fnod_0864
   00020 Citrate cycle (TCA cycle)
    Fnod_0864
   00620 Pyruvate metabolism
    Fnod_0864
   00640 Propanoate metabolism
    Fnod_0864
   00650 Butanoate metabolism
    Fnod_0864
  Energy metabolism
   00680 Methane metabolism
    Fnod_0864
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Fnod_0864
Enzymes [BR:fno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Fnod_0864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N HSV_VP16_C Ribul_P_3_epim
Motif
Other DBs
NCBI-ProteinID: ABS60716
UniProt: A7HLD3
Position
complement(939484..940653)
Genome map
AA seq 389 aa AA seqDB search
MPLKQAITGAEAIAYAMKQINPDVVAAYPITPQTPVVEYFAKYVADGVVDTEMIPVESEH
SAMSAVVGAAAAGARAFTATASVGLALMHEVVFIAASLRLPIVMAVANRALSGPINIHCD
HSDAMAERDSGWIQLWAENAQEAYDFTVMAYRIAEHPDIRLPVMVNFDGFIISHGVEVVE
TLDDEVVKQFVGKPIRMNSLLDTSKPVTYGALDLYDYYFEHKRSQIEAMKHVPRVFKEVA
EEFAKISGRKYDLVDEYMVDDAQYVMVALGSTAGTIKHTINELRKEGKKVGLVKPWVFRP
FPKAEYQRILNGRKAVVVLDRSASFGAEAPLYETVKSALYEVAVRPQMGSYVYGLGGRDI
TPAHIRQAFEDAFNGNLIVDEERYLGLRE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaaaacaagcaattacaggtgcagaggcgatagcctatgcaatgaaacaaata
aatccagacgttgttgcagcgtatcctattacaccacaaacgccagttgttgaatacttc
gcgaaatatgttgcagatggtgttgttgacactgaaatgatacctgttgaaagcgaacac
tctgcaatgagtgctgttgttggcgcagcagctgctggtgcaagggcgtttacggcaaca
gcttccgttggtcttgctcttatgcacgaggttgttttcatagcagcttctttaagactt
ccaatagtaatggcagttgcgaatagggcgctctcaggaccaatcaatattcactgtgac
catagtgacgcgatggctgaaagagatagtggatggatacaactttgggcagaaaatgct
caagaagcttacgactttacagtcatggcttacagaatcgcagaacatccagatataaga
ctcccagttatggtgaactttgatggatttattatttcgcatggtgttgaagtagtagaa
acacttgatgatgaagttgttaagcaatttgttggaaaaccaataagaatgaattcatta
cttgatacatctaaacctgttacatatggtgctcttgatttgtacgattattactttgaa
cacaagagaagtcaaattgaagcgatgaaacatgtcccaagagtttttaaagaagtcgca
gaagaattcgcaaagatttcaggaagaaaatatgatttggttgatgagtacatggttgat
gatgctcaatatgtcatggtagcattaggttcaaccgccggaacaataaaacatacaatt
aacgagttaagaaaagaaggtaaaaaagttggacttgttaaaccatgggtatttagacca
ttcccaaaagcggaatatcaaagaatattaaatggaagaaaagctgttgtagttcttgac
aggtcagcttcatttggtgcagaagctccactttatgaaacggtaaaatccgcactttat
gaagttgctgttagaccacaaatgggaagctatgtctacggtcttggtggaagggatata
acacctgctcacattagacaggcattcgaagatgcattcaacggcaatttaattgtcgac
gaagaaagatatcttgggcttagagagtga

DBGET integrated database retrieval system