KEGG   Fervidobacterium nodosum: Fnod_1279Help
Entry
Fnod_1279         CDS       T00579                                 

Definition
(GenBank) Methylenetetrahydrofolate reductase (NAD(P)H)
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
fno  Fervidobacterium nodosum
Pathway
fno00670  One carbon pool by folate
fno01100  Metabolic pathways
fno01120  Microbial metabolism in diverse environments
fno01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Fnod_1279
Enzymes [BR:fno01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Fnod_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ABS61126
UniProt: A7HMJ3
Position
complement(1381778..1382719)
Genome map
AA seq 313 aa AA seqDB search
MKIVEKLRNEKIVSIEIIPPKRGEDVEKIFATLDKLMDYNISFINITRHPSEIDYLETEN
GIIKVQKIKRPGTIGLTAALMKRYNIDVVPHLVCKGMNKFEMEDILIDLSIMGVENVFVV
RGEEVKSVAKSDYKYASDLVKQISDMNNGRYLYTEAKPTNFCIGVAGYPEKHFEAPNLDV
DLRFLKQKVDNGADFIITQMVFDAAIYEKFVEKSRSMGINIPIIPGVKPVVSKKSIYSIP
KKFFVNIPQKFVEKMEEAKSESEEFEIGVRFTVELIKNLLEKDAPGVHIFTMGRGEEVCK
VLKLLREGGILNV
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatcgttgaaaaattaagaaatgaaaagatagtttcgatagagataatccctcct
aagagaggagaagatgttgaaaaaatatttgccactttagataagttgatggattataac
atatctttcataaatataacgcgccatccgtctgaaatagattatttagaaacggaaaat
ggaataattaaggttcaaaagataaaaagaccaggaacaataggtttgactgccgctttg
atgaaaaggtacaatatcgatgttgttcctcatttggtttgcaaaggtatgaacaaattt
gagatggaggatattttaatagacttgtctataatgggtgttgaaaatgtctttgtagtg
cgtggggaagaagttaaatctgtagcgaagagtgactataaatatgcttcagatttggtt
aagcaaatatctgatatgaacaatgggagatacctttacacagaagccaaaccaacaaat
ttttgtataggagttgcgggatatccagaaaagcattttgaagctccgaatctagacgtt
gatttaaggtttttaaaacagaaagttgataatggcgctgattttataataactcaaatg
gtttttgatgcagcaatttatgaaaaatttgttgaaaaatctcgaagtatggggataaat
ataccgattataccgggtgtaaaacctgtggtaagtaagaagtcaatttattctattcca
aagaagtttttcgtgaatattccacaaaaatttgttgaaaaaatggaagaagctaaatct
gaaagtgaagaatttgaaataggtgtccgttttactgttgaactaatcaaaaatcttctt
gaaaaagatgctccgggggttcatatttttacgatgggacgaggggaagaagtttgcaag
gttttgaagttactaagagaaggaggaattttaaatgtctga

DBGET integrated database retrieval system