KEGG   Fervidobacterium nodosum: Fnod_1642
Entry
Fnod_1642         CDS       T00579                                 

Definition
(GenBank) cobalamin B12-binding domain protein
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
fno  Fervidobacterium nodosum
Pathway
fno00472  D-Arginine and D-ornithine metabolism
fno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Fnod_1642
Enzymes [BR:fno01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Fnod_1642
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: ABS61477
UniProt: A7HNJ4
Position
complement(1788607..1790808)
AA seq 733 aa
MDKLDPRKQIDVEEILKDLDKYRPKRRGWTWRKKLPEGTKIDRYDYHQISELLKNSIPLP
AAHYFNNIDPQPDVVITSEIASGRFEDDIRRMRMAAWHGADHIMVIRTLGQSHFDGLIEG
TPEGVGGIPITRKQVRATRKALDLIEEEVGRPINFHSYVSGVAGPEIAVLFAEEGVNGAH
QDPQYNVLYRGVNPVRSFVDAAVAKKIMAWANMLQIDGAHNANASAKLAWTVMPELLVQH
GINCMYSVKVGMPKENIALSTVPPVIAPLPEMRIDLPYAVALRELFQGYRFRAQMNTRYI
ESDLFDATRAHVLNAVLSRLTSADLQSTITPDEGRNVPWHINSIRGVETAKHTLLAMDGI
KKYVKIDQEAIREKVRELKMRAILMLEEIIEMGGYFEALEAGMFVDNGYYPERFGDGIAR
KKDGELAAGTVVPRDHDYMAPVCEHFGYNNLPEGLEKPCDLINGCTFHNPDKIQFIDELD
ETDNVNLRLEKIKDMKKRNVIKPEVEWFADGWIQLDMTFSLPEEYAEAAALAVCEKLGLE
EPTIIAKTVLHPSEGTYVEVKAKVPFEIKIDELELPKKPETLPEEELFSFVEKRPIKVVA
ATVGEDEHSVGLREVLDIKHGGIEKYGIKYVYLGTSVPPEKLIDAAIETGADAILASMII
THNDVHIKNMRRLNELAIEKGIRDKVLIIVGGTQINNDMAIENGVDAGFGRGTKGIHVAS
FIVKKLKERESQK
NT seq 2202 nt   +upstreamnt  +downstreamnt
atggacaaactcgacccaagaaaacaaatcgacgttgaagaaatattaaaagacttagat
aaatatagacctaagagaagaggttggacttggagaaagaaattgccagaagggacaaaa
atagacagatacgattatcaccaaataagtgagcttttgaaaaacagtataccactacct
gctgctcactatttcaacaacatagatcctcaaccagatgttgttataacttccgaaatc
gcttcaggaaggtttgaagacgatattaggcgtatgagaatggcggcatggcatggtgct
gaccatattatggttatccgcacacttggtcaatcacacttcgatggtcttatagaaggg
acaccagaaggtgtaggtggaatccctataacaagaaaacaagttagagcaacaagaaaa
gcccttgatttaatcgaagaagaagttggaagaccgataaatttccacagctacgtttcg
ggcgtcgcaggtccagaaattgcagttttattcgctgaagaaggagttaacggcgcacac
caagacccacagtacaatgtcttatacaggggtgtcaatccagtcaggtcatttgtagat
gctgcagttgcaaaaaagataatggcatgggcaaatatgctccaaatagatggtgcacat
aacgccaatgcatcagcaaaattggcatggaccgttatgccagaattactggtccagcat
ggtatcaattgtatgtattctgtcaaagttggtatgccaaaagaaaacatcgcactttca
acagtcccaccagtaattgctccacttccagaaatgcgtatcgatttaccatacgctgtc
gcacttagagaacttttccaaggctacagatttagagcgcagatgaatacacgatacatt
gaatctgacttattcgacgcaacaagagcgcatgttctcaacgcagtactttcaagacta
acaagcgcggatttacaatcaacaattacaccagacgaaggaagaaacgttccatggcat
ataaattccatacgtggtgtggaaactgcaaagcatacattgcttgcaatggacggaatt
aaaaaatacgtaaagatagaccaagaagcgataagggaaaaagttagagaactaaaaatg
cgagctatactaatgctcgaagagataatcgaaatgggaggctatttcgaagctcttgaa
gctggaatgttcgttgacaatggatattatccagaaagattcggcgatggaatagcgaga
aaaaaagatggagaattagccgccggtacggttgtaccaagagaccacgattacatggca
ccagtttgtgaacactttggttacaataacttacctgaagggttggaaaaaccatgcgac
ttaattaacggatgtacgttccataatcctgataaaatacagttcattgatgagcttgat
gaaacagataacgttaatttaagacttgaaaaaattaaagatatgaaaaaacgaaacgtg
ataaaacctgaagttgaatggtttgccgatggttggatacagctagatatgactttctca
ttgcccgaagaatacgcagaagccgcggcacttgccgtatgtgaaaaacttggtcttgag
gaaccaacaattatagctaagacagtacttcacccatctgaaggtacatacgttgaagta
aaagcaaaagtgccatttgaaattaaaatcgatgaacttgaacttcctaagaaaccagaa
actttacctgaagaagaacttttcagcttcgtcgaaaaacgcccaattaaagttgtagct
gccactgttggtgaagacgagcattcagttggcttaagggaagtacttgacataaaacac
ggtggtatagaaaagtatggtataaaatatgtttacctcggtacaagcgtgccaccagaa
aaattaattgatgctgccatagaaaccggagcagacgctattttggcatcgatgataatt
acacataacgatgtgcacatcaaaaatatgagaagattaaacgaactggcgatagaaaaa
ggaataagggataaagtactcatcatagtcggaggaacacagataaataacgacatggca
atagaaaatggagtagacgcaggttttggcagagggacgaaaggtatccatgtagcatcg
tttattgtcaaaaaactaaaagaaagagaatctcaaaaataa

DBGET integrated database retrieval system