KEGG   Fervidobacterium nodosum: Fnod_1643
Entry
Fnod_1643         CDS       T00579                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
fno  Fervidobacterium nodosum
Pathway
fno00472  D-Arginine and D-ornithine metabolism
fno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Fnod_1643
Enzymes [BR:fno01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Fnod_1643
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A DUF2067
Other DBs
NCBI-ProteinID: ABS61478
UniProt: A7HNJ5
Position
complement(1790808..1791191)
AA seq 127 aa
MKPRPDDFVERSKHLQNMTDEELNAYFWSLVEKIVDPLVELARTHTSPSIERSVLLRMGF
NSIEAKKLVDMIFEKGLLGKGAGHIVWRIAKEHNIDYIEAGRRMINGQYWDDVDRIFKGI
NKGAVSK
NT seq 384 nt   +upstreamnt  +downstreamnt
atgaaaccaaggccggacgattttgtagaaaggtcaaaacacttgcaaaacatgacagac
gaagaattaaacgcatatttttggagtcttgttgaaaaaattgtcgatccattagttgaa
ctcgctagaacacatacttcaccatcgattgaaaggtcagtacttttgagaatgggattt
aacagtatcgaagctaagaaactagttgatatgattttcgaaaaaggacttcttggcaaa
ggtgctggccatattgtttggcgaattgcaaaggagcataacatcgattatatagaagca
ggtagaagaatgattaacggtcaatactgggatgatgtggatagaatattcaaaggtatt
aataaaggggcggtgagtaaataa

DBGET integrated database retrieval system