KEGG   Fusobacterium nucleatum subsp. vincentii 3_1_27: HMPREF0405_01915Help
Entry
HMPREF0405_01915  CDS       T03625                                 

Definition
(GenBank) hypothetical protein
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
fnt  Fusobacterium nucleatum subsp. vincentii 3_1_27
Pathway
fnt00620  Pyruvate metabolism
fnt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fnt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HMPREF0405_01915
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fnt02000]
    HMPREF0405_01915
Enzymes [BR:fnt01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     HMPREF0405_01915
Transporters [BR:fnt02000]
 Other transporters
  Primary active transporters [TC:3]
   HMPREF0405_01915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: EFG33722
Position
1:1672197..1673543
Genome map
AA seq 448 aa AA seqDB search
MNKIKIMETCLRDGHQSLMATRLTTAEMLPIIEKLDNVGYHSLEMWGGATFDAALRFLNE
DPWERLREIKKRVKNTKLQMLLRGQNLLGYRNYPDDIVERFVKKSIQNGIDIVRIFDALN
DVRNLQTACEATKKYGGHAQLAMSYTISPVHTIEYFKNLALEMQEIGADSIAIKDMSGIL
LPEVAYELVKELKSVLRVPVEVHTHATAGLASMTYIKAVEAGADIIDTAISPLSGGTSQP
ATESIVRAFQGTERETGFDLGLLKEIAEYFKPIRAKYLQEGILNPQALMTEPSIVEYQLP
GGMLSNFLSQLKMQKAENRYEDVLREIPRVRKDLGYPPLVTPLSQMVGTQAIFNILTGQR
YKLIPNEIKNYVRGLYGKSPVPISDEIKKTIIFDEEVFTGRPADKLAPEYDKMVEETRDF
ARSEEDVLSYALFPQVAKDFLIKKYENE
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgaataagattaaaattatggaaacttgtctaagagatggacaccaatcacttatggct
actcgtttaactaccgctgaaatgttaccaataattgaaaaattagataatgtgggctac
cattcattagaaatgtggggaggagcaacttttgatgctgctctaagatttcttaatgaa
gacccttgggaaagattgagagaaatcaaaaagagagttaaaaatacaaaacttcaaatg
ttacttagagggcaaaatcttttaggttatcgtaactatcctgatgatatagttgaaaga
tttgttaaaaaatccatacaaaatggaatagatatagttcgtatatttgatgctttaaat
gatgttcgtaacttacaaactgcttgtgaagctacaaaaaaatatggtggacatgctcaa
cttgcaatgagctatactatcagccctgttcatactattgaatactttaagaatttagct
ttggaaatgcaagaaattggagctgattctattgctataaaagatatgtctggaatttta
ttaccagaagttgcttatgaattagtaaaagagttaaaatctgtactaagagttcctgtt
gaagtgcatactcatgcaactgctggacttgcaagtatgacttatatcaaagctgttgaa
gcaggagcagatataattgacactgctatatctccattatctggtggaacatctcaacct
gctactgaaagtatagttagagcttttcaaggaactgaaagggaaactggttttgattta
ggattattaaaagaaatagcagaatactttaagcctataagagcaaaatatttacaagaa
ggtattttaaatccacaagctcttatgactgagccaagtatagttgaatatcaattacca
ggaggaatgctatcaaattttctttctcaattaaaaatgcaaaaagccgaaaatagatat
gaagatgttttaagagaaatcccaagagtaagaaaagacttaggatatccaccattagtt
actcctcttagccaaatggttggaacacaggctatatttaatatattaactggacaaaga
tataaactgataccaaatgaaattaaaaactatgtgagaggactctatggtaaaagtcca
gtacctatatctgatgaaattaaaaagactattatctttgatgaagaagtattcacagga
agacctgctgataaattagctcctgaatatgataaaatggttgaagaaacaagagatttt
gcaagaagtgaagaagatgtattatcttatgctcttttcccacaagttgcaaaagatttt
ttaataaagaaatatgaaaatgaataa

DBGET integrated database retrieval system