KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0262
Entry
FN0262            CDS       T00077                                 

Name
(GenBank) Formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
fnu00620  Pyruvate metabolism
fnu00640  Propanoate metabolism
fnu00650  Butanoate metabolism
fnu01100  Metabolic pathways
fnu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FN0262
   00640 Propanoate metabolism
    FN0262
   00650 Butanoate metabolism
    FN0262
Enzymes [BR:fnu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     FN0262
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: AAL94468
UniProt: Q8RGM9
Position
complement(887666..889897)
AA seq 743 aa
MEAWRGFKSGEWQNSINVSDFIKHNYTEYLGDESFLEGPTENTKKLWDILSGMLKIEREK
GIYDAETKTPSKIDAYGAGYISKDLETIVGLQTDAPLKRAIFPNGGLRMVESSLEAFGYK
LDPTTKEIYEKYRKSHNAGVFSAYTPAIKAARHTGVITGLPDAYGRGRIIGDYRRVALYG
VDRLIEERKREFDAYDPEEMTEDVIRDREEMFEQLEALKALKRMAAAYGFDIGRPAETAQ
EAIQWTYFGYLGAIKDQNGAAMSLGKTAGFLDVYIERDLKEGRITEKQAQEFIDHFIMKL
RIVRFLRTPEYDQLFSGDPVWVTESIGGMNNDGKSWVTKNAYRYLNTLYNLGTAPEPNLT
ILWSERLPENWKKFCSKVSIDTSSLQYENDDIMRPQFGEDYGIACCVSPMAIGKQMQFFG
ARANLPKALLYAINGGKDELKKDQVTPAGQFERITSDYLDFDEVWEKYDKMLTWLASTYI
KALNIIHYMHDKYSYEALEMALHSLDIKRTEACGIAGLSIVADSLAAIKYGKVRVIRDEA
GDAVDYVVEQPYVPFGNNDDRTDELAVKVVRTFMNKIRSHKMYRDAEPTQSVLTITSNVV
YGKKTGNTPDGRRAGAPFGPGANPMHGRDTKGAVASLASVAKLPFEDANDGISYTFAITP
ETLGKTDDEKKNNLVGLLDGYFKQTGHHLNVNVFGRELLEDAMEHPENYPQLTIRVSGYA
VNFIKLTREQQLDVINRTISNKM
NT seq 2232 nt   +upstreamnt  +downstreamnt
atggaagcttggagaggttttaaaagtggtgaatggcaaaatagtattaatgtaagtgat
tttataaaacataactatacagaatatttaggggacgaatcattcttagaaggtcctact
gaaaatactaaaaaattatgggatattttaagtggaatgttaaagatagaaagagaaaaa
ggtatatatgatgctgaaactaaaactccttctaaaatagatgcttatggagcaggatat
atttctaaagatttagaaacaatagtaggtttacaaactgatgctcctttaaaaagagct
atattcccaaatggtggattaagaatggttgaaagttcattagaagcttttggttacaag
ttagatcccacaacaaaagaaatctatgaaaaatatagaaaaagtcataatgctggagtt
ttctcagcttatacacctgcaataaaagctgcaagacatactggagttattactggactt
cctgatgcttatggtagaggaagaatcataggagattatagaagagttgctctttatggt
gttgatagacttattgaagaaagaaaaagagaatttgatgcttatgatcctgaagaaatg
acagaagatgttatcagagatagagaagaaatgtttgaacaattagaagcattaaaagca
ttaaaaagaatggctgctgcttatggttttgatataggaagacctgctgaaactgctcaa
gaagctattcaatggacttattttggatacttaggagctattaaagaccaaaatggtgct
gcaatgagtttaggtaaaactgctggtttcttagatgtatatatagaaagagacttaaaa
gaaggaagaatcactgaaaaacaagcacaagaatttatagaccatttcatcatgaaactt
agaattgtaagattcttaagaactcctgaatatgaccaattattctctggagatccagta
tgggtaactgaatcaataggtggtatgaataatgatggtaaatcttgggtaacaaaaaat
gcttatagatatttaaatactttatataatttaggaacagctcctgaacctaacttaaca
attttatggagtgaaagattaccagaaaattggaaaaaattctgttcaaaagtttcaata
gatacatcttcattacaatatgaaaatgatgatattatgagaccacaatttggtgaagac
tatggaatagcttgttgtgtatctcctatggctataggaaaacaaatgcaattctttgga
gcaagagctaacttacctaaagcattactttatgctataaatggtggtaaggatgaatta
aagaaagaccaagtaacacctgctggtcaatttgaaagaattactagtgactacttagat
tttgatgaagtttgggaaaaatatgataaaatgcttacttggcttgcttcaacttatata
aaagcactaaatattattcactatatgcatgataaatattcttacgaagcattagaaatg
gctttacactcattagatattaagagaacagaagcttgtggtatagctggactttcaata
gttgctgactcacttgctgctattaaatatggtaaagtaagagtaataagagatgaagct
ggagatgctgttgattatgttgttgaacaaccttatgttccatttggaaataacgatgat
agaacagatgaattagcagttaaagtcgttagaacatttatgaataaaattagaagtcat
aaaatgtatagagatgctgaacctactcaatcagttcttacaataacttcaaatgttgtt
tatggtaagaaaacaggaaatactcctgatggaagaagagcaggagctccatttggacca
ggagcaaaccctatgcatggaagagatactaagggagcagttgcttctctagcatcagtt
gctaaattaccatttgaagatgcaaatgatggaatttcttatacattcgctataactcct
gaaacattaggaaaaacagacgatgaaaagaaaaataacctagttggacttcttgatgga
tactttaaacaaactggacatcacttaaatgtaaatgtatttggtagagagctattagaa
gatgctatggaacatcctgaaaattatccacaacttacaataagagtttctggatatgca
gtaaactttatcaaattaacaagagaacaacaattagatgttataaacagaactataagt
aacaaaatgtaa

DBGET integrated database retrieval system