KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0729Help
Entry
FN0729            CDS       T00077                                 

Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
fnu00010  Glycolysis / Gluconeogenesis
fnu00260  Glycine, serine and threonine metabolism
fnu00680  Methane metabolism
fnu01100  Metabolic pathways
fnu01110  Biosynthesis of secondary metabolites
fnu01120  Microbial metabolism in diverse environments
fnu01130  Biosynthesis of antibiotics
fnu01200  Carbon metabolism
fnu01230  Biosynthesis of amino acids
Module
fnu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fnu_M00002  Glycolysis, core module involving three-carbon compounds
fnu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FN0729
  Energy metabolism
   00680 Methane metabolism
    FN0729
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FN0729
Enzymes [BR:fnu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     FN0729
Membrane trafficking [BR:fnu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    FN0729
Exosome [BR:fnu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   FN0729
  Exosomal proteins of melanoma cells
   FN0729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 MIF4G_like Imm70 Sortase
Motif
Other DBs
NCBI-GeneID: 991611
NCBI-ProteinID: NP_603626
UniProt: Q8RFG9
Position
1386494..1387180
Genome map
AA seq 228 aa AA seqDB search
MKLVLIRHGESAWNLENRFTGWKDVDLSPKGMEEAKSAGKILKEMNLVFDVAYTSYLKRA
IKTLNIVLEEMDELYIPVYKSWRLNERHYGALQGLNKAETAKKYGDEQVHIWRRSFDVAP
PSIDKNSEYYPKSDRRYADLADSDIPLGESLKDTIARVLPYWHSDISKSLQEEKNVIVAA
HGNSLRALIKYLLNISNEDILNLNLVTGKPMVFEIDKDLKVLSSPELF
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagttttaattcgtcatggagaaagtgcatggaacttagaaaatagatttaca
gggtggaaagatgttgatttaagtccaaaaggaatggaagaagcaaaatcagcaggaaaa
attttaaaagaaatgaatttagtttttgatgttgcctatacttcatatttaaaaagagca
atcaaaactttaaatattgttttagaagaaatggatgaattatatattccagtatataaa
tcttggagattaaatgaaagacactatggagcattacaaggattaaataaagcagaaact
gcaaaaaaatatggagatgaacaagtacatatttggcgtcgtagttttgatgtagctcca
ccaagtattgataaaaatagtgaatattatccaaagtcagatagaagatatgcagattta
gcagattctgatattccattaggagagagtttaaaggatacaatagcaagagtattacct
tactggcattctgatatttcaaaaagtttgcaagaagaaaaaaatgttatagttgctgct
catggaaatagtttaagagcattaataaaatatttattaaatatttctaatgaagatatt
ttaaatctaaacttagttacaggaaaacctatggtatttgaaatagataaagatttaaaa
gtgttatcttcacctgaattattttaa

DBGET integrated database retrieval system