KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0810Help
Entry
FN0810            CDS       T00077                                 

Definition
(RefSeq) low-specificity threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
fnu00260  Glycine, serine and threonine metabolism
fnu01100  Metabolic pathways
fnu01110  Biosynthesis of secondary metabolites
fnu01120  Microbial metabolism in diverse environments
fnu01130  Biosynthesis of antibiotics
fnu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fnu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FN0810
Enzymes [BR:fnu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     FN0810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 993111
NCBI-ProteinID: NP_603707
UniProt: Q8RFA6
Position
1469178..1470200
Genome map
AA seq 340 aa AA seqDB search
MINFKNDYSEGACSEVLEALIKTNYEQTVGYGEDEYCEKAKNLIKENINYPNANIYFLVG
GTQANTTVISHSLRPYEAVIACKTGHISIHETGAIEATGHKIIEVDGIDGKLTPDLILNE
LRKHEDHHMVKPKMVYISNTTEIGTVYTKKELENISKVCKDNNLYLYLDGARLASALTSE
KCDINLEDYPRYCDVFYIGGTKCGLLFGEAVVIINDEIKKEFNFSVKQKGGLFAKGRLLG
IQFATLFKDDLYYRIGVHSNKMALKIKNAFIEKGIKLATDSYTNQVFVDLSQEQIKKLEK
DVIFSVEFFGIGESQSSRFVTSWATKEEDIDKLVELIKSL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgataaattttaaaaatgattatagtgaaggagcttgttcagaagtactggaagcattg
ataaaaactaattatgagcaaacagtaggttatggagaagatgaatactgtgaaaaggct
aaaaatttaattaaagaaaatattaattatcctaatgcaaatatttattttttagttggt
gggacacaagcaaatacaactgttatttctcactctctaagaccttatgaagctgttatt
gcttgtaagacaggacatatctctatacatgaaacaggagctattgaagctactggacat
aaaataattgaagtagatggaattgatgggaaattaactcctgatttaattttaaatgaa
ttaagaaaacatgaagatcatcacatggtaaaacctaaaatggtttatatttcaaatact
actgaaataggaactgtttatactaaaaaagaattagaaaatattagtaaagtttgtaaa
gataataatttatatttatatttagatggtgcaagacttgcatctgcacttacctctgaa
aaatgtgatataaatttagaagattatccaagatattgtgatgttttctatattggtgga
acaaaatgtggcttattatttggtgaagcagttgtgattataaatgatgagataaagaaa
gaatttaacttttctgttaaacaaaaaggtggattatttgcaaaaggaagattattagga
atacagtttgcaactttatttaaagatgatttatattatagaataggtgttcattcaaat
aaaatggcattaaaaataaaaaatgcttttatagaaaaaggtattaagttagctactgat
tcttatactaaccaagtttttgtagatttaagtcaagaacaaataaaaaaattagaaaaa
gatgttatattttcagtagaattttttggaataggagaaagtcaatcatcaagatttgta
acttcttgggcaacaaaagaagaagatattgataaacttgtagaactgattaaatctctt
taa

DBGET integrated database retrieval system