KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0965
Entry
FN0965            CDS       T00077                                 

Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
fnu00260  Glycine, serine and threonine metabolism
fnu00270  Cysteine and methionine metabolism
fnu00680  Methane metabolism
fnu01100  Metabolic pathways
fnu01110  Biosynthesis of secondary metabolites
fnu01120  Microbial metabolism in diverse environments
fnu01200  Carbon metabolism
fnu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fnu00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    FN0965
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FN0965
   00270 Cysteine and methionine metabolism
    FN0965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fnu04147]
    FN0965
Enzymes [BR:fnu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     FN0965
    1.1.1.399  2-oxoglutarate reductase
     FN0965
Exosome [BR:fnu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FN0965
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh AdoHcyase_NAD Oxidored_nitro Lactamase_B_6 PAP_central NERD
Other DBs
NCBI-ProteinID: AAL95161
UniProt: Q8REX0
Position
complement(1618418..1619383)
AA seq 321 aa
MEKNKLKILFLDRNAVGPYELKGIFSKYGEYTELNLTNNDDIASYLKDYDVVILNRIRLG
KKEFEKTPHLKLVLLTGTGYNHIDLVAAKEYGVTIANVANYSTNSVSQLTMTLLLNELTR
AEKLSQEVKQNKWEEISNKMDRYYHVDTEGKVLGILGHGNIGKKVESYAKSFGMEVMIAK
IPGREYTDNLENRFELDEVLEKCDIFSIHAPLTDLTRDLINLDRMKKMKKSAIILNLGRG
PIINEEDLYYVLKNKIISSAATDVMTTEPPQNDCKLLELDNFTVTPHLAWKSLKSVERLF
AAIENNLNLFLENKLIGLESK
NT seq 966 nt   +upstreamnt  +downstreamnt
atggaaaaaaataagttaaaaatattatttttagacagaaatgcagtaggaccttatgaa
ttaaaaggaatattttcaaagtatggagaatacacagagcttaatcttacaaataatgat
gatatagcaagttatttaaaagattatgatgttgtaattttaaatagaattagattaggt
aaaaaagaatttgaaaaaactcctcatttaaaattagttttattgactggaactggatat
aatcatatagatttagttgcagcaaaggaatatggagtaactattgctaatgtagcaaac
tattctactaattcagtatctcaacttacaatgacacttttgttaaatgaattaacaaga
gcagaaaaattaagtcaagaagtaaaacaaaataagtgggaagaaatttctaacaaaatg
gatagatactatcatgtagatacagaaggtaaagttttaggaattttaggacatggaaac
ataggaaagaaagttgaaagctatgctaaaagttttggtatggaagttatgatagctaaa
attcctggaagagaatatacagataacttagaaaatagatttgaattagatgaagtccta
gaaaaatgtgatatattttctattcatgcaccattaactgatttaacaagagatttaata
aatttagatagaatgaaaaaaatgaaaaagtctgcaataattttaaatttaggaagaggt
cctataataaatgaagaagatttatattatgtattgaagaataaaataatttcttcagca
gcaactgatgtaatgacaacagaacctcctcaaaatgactgcaaattacttgaattagat
aattttacagtaactccacatttagcttggaaatccttaaaaagtgtggaaagacttttt
gcagcaattgaaaataatctaaatttatttttagaaaacaaactaataggtctagaaagt
aagtaa

DBGET integrated database retrieval system