KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN1266Help
Entry
FN1266            CDS       T00077                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
fnu00040  Pentose and glucuronate interconversions
fnu00052  Galactose metabolism
fnu00500  Starch and sucrose metabolism
fnu00520  Amino sugar and nucleotide sugar metabolism
fnu01100  Metabolic pathways
fnu01130  Biosynthesis of antibiotics
Module
fnu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FN1266
   00052 Galactose metabolism
    FN1266
   00500 Starch and sucrose metabolism
    FN1266
   00520 Amino sugar and nucleotide sugar metabolism
    FN1266
Enzymes [BR:fnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     FN1266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-GeneID: 992081
NCBI-ProteinID: NP_604163
UniProt: Q8RE59
Position
complement(1922248..1923153)
Genome map
AA seq 301 aa AA seqDB search
MSLKEAFMKKVTKAVIPAAGLGTRVLPATKALPKEMLTIVDKPSLQYIVEELVDSGITDI
VIITGRNKNSIEDHFDFSYELENTLKNDNKLDLLEKVSHISNIANIYYVRQSMPLGLGHA
VLKAKSFIGDEPFVIALGDDIIYNPEKPVTKQMIEKYELYGKSIIGCQEVAKEDVSKYGI
AKLGHKVDETTYQMLDFLEKPSVNEAPSRTACLGRYLLSGKVFKYLEETKPGKNGEIQLT
DGILAMMRDNEEVLAYNFIGKRYDIGSKFGLLRANIEFGLRNEETKEEVKEYLKKLDIEK
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaaaggaggcttttatgaaaaaagttactaaggctgttatacctgctgctggt
ttaggaacaagagttttaccagcaacaaaagcactgccaaaggaaatgcttacaatagtt
gataaaccatctttacaatatatagttgaggagttagttgactctggaataacagatatt
gtaataataacaggaagaaataaaaattcaatagaagatcatttcgatttttcttatgaa
ttagaaaatactttaaaaaatgataataaattagatttattagaaaaagtttcacatata
tcaaatattgcaaatatttactatgtaagacaaagtatgccacttggtttaggacatgca
gtattaaaagctaaatcttttattggagatgaaccctttgttattgctttaggagatgac
atcatatataatcctgaaaaaccagttactaaacaaatgattgaaaaatatgagctttat
ggaaagagcataataggatgtcaagaagtagcaaaagaagatgtttctaaatatggtata
gcaaaattagggcataaggttgatgaaactacttatcagatgttagattttttagaaaag
ccctctgtaaatgaagctccttcaagaacagcttgtttaggaaggtatttactttcagga
aaagtatttaaatatttagaggaaacaaaacctggaaaaaatggagaaatccaattaaca
gatggaatacttgctatgatgcgagataatgaagaggttttagcatataattttattggc
aaaagatatgatataggaagtaaatttggattacttagagctaatattgagtttggactt
agaaatgaagaaacaaaagaagaagttaaagaatatctaaaaaaattagatatagaaaaa
atataa

DBGET integrated database retrieval system