KEGG   Formosa sp. Hel3_A1_48: FORMA_11780Help
Entry
FORMA_11780       CDS       T04482                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
foh  Formosa sp. Hel3_A1_48
Pathway
foh00360  Phenylalanine metabolism
foh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
foh00790  Folate biosynthesis
foh01100  Metabolic pathways
foh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:foh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    FORMA_11780
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FORMA_11780
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FORMA_11780
Enzymes [BR:foh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     FORMA_11780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AOR26341
UniProt: A0A1D7XSP1
Position
1223508..1225247
Genome map
AA seq 579 aa AA seqDB search
MAPIAAYSEEVIERLPAHLKQFIAPQNYEEYTPVNQAVWRYVMRKNISYLKDVAHQSYIG
GLKKTGVLVESIPNIYGMNRILKDIGWAAVAVDGFIPPNAFMEFQANKVLVIASDIRQLE
HIEYTPAPDIIHEASGHAPIIANPDYAEFLRRLGEIGAKAILSKYDIDLYEAVRKLSILK
EAPGVKQKDIDAAELEVNVLQNQHEEYSEMAQIRNMQWWSVEYGLIGEMNNPKIYGAGLL
SSIGESEWCMRDDVEKIPYSVDVAQVGFDITKPQPQLFVTPNFAYLMEVLEELANTLSVR
KGGYKGLQKLIDSKAIGTIELSTGLQVSGVFTQMIMNDDREVIYFKTDGPTALAYRDKEL
IGHGIKAHKDGYSSPLGMLKSVNLPIENMTPVDLKAYNLYDGQRLAFEFESGITVEGLNI
TGIRNVKGKIMLIQLKDCTVRYGKEVLFKPEFGVFDMAIGNNIVSAFAGAADSSSFPNLY
AVSKTKTIKTKKKPKNIALEQLYQSVRSYRTTKRFSSSDLEKVFETLVKNHKNDWLLQIE
LLELTEDSSLILKIKKHLAEIIQNKPELSRLIESGIRLI
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggcacctattgctgcttattccgaagaagttattgaaaggcttccagctcatttaaaa
caatttatcgcaccacagaattatgaggagtatacgccagttaaccaagcagtatggcga
tatgttatgagaaaaaacatctcttacctaaaagatgttgcgcaccaatcttatattggt
ggacttaaaaaaacgggggttctcgtcgagtcaattccaaacatctacggaatgaatcgt
atccttaaagatattggttgggcggctgtagctgtcgatggttttattccgcccaatgcc
tttatggagtttcaagctaataaggtacttgttattgcttctgatataagacagctcgaa
catatcgagtatacgccagcacccgatattattcatgaggcatcaggtcatgcgccaatc
attgcaaatcctgattatgcagaatttttaaggcgtcttggtgaaattggtgcaaaagct
attctttctaaatacgatattgatctgtatgaagcggtgcgtaaactctctattctaaaa
gaagcgcccggagtaaaacaaaaagatattgatgccgcggaactagaggttaacgtcctt
caaaaccaacacgaagagtactcggaaatggcacaaataagaaatatgcagtggtggagt
gttgaatacggcttaataggagaaatgaataatcctaaaatatatggcgctggcttgttg
tcctcaatcggggaaagcgaatggtgtatgcgtgatgatgttgaaaaaattccttactca
gttgatgtggctcaggtgggttttgatatcacaaaaccccaacctcaactttttgtaaca
ccaaattttgcatacttaatggaagtgcttgaagagcttgctaatacactaagcgtaaga
aaaggagggtataaaggcctacagaagcttattgattcaaaagcaataggtacaattgag
ctgagtacagggttgcaggtttccggagtatttacccaaatgatcatgaacgacgataga
gaggttatctactttaaaactgatggccctacagctctggcgtacagagataaagaactt
attggtcatggaattaaagcacacaaagatggatacagctctccgttgggtatgctgaaa
agcgtcaaccttccgattgaaaacatgactccagtagacctaaaggcatataatttatac
gacggccagcgcttagcttttgaatttgaaagcggtataacggtcgaaggtttaaacatt
acaggtataagaaatgtaaaaggtaaaatcatgcttatacagctcaaggattgtacagta
cgctatggcaaagaggttctttttaaacctgaatttggggtctttgacatggctattgga
aataacattgtttctgcgtttgcgggtgcggcagacagcagctcttttccaaacctatat
gcggtgtcaaagaccaaaacaattaaaactaagaaaaagcccaaaaatatagcccttgaa
cagctctaccaaagtgttcggtcttatagaacaactaagcgtttctcatcaagcgatttg
gaaaaagtttttgaaacactagttaaaaatcacaaaaacgactggttacttcaaattgaa
cttttggaacttacggaagatagtagcttaattctcaagatcaaaaaacacttagctgaa
atcattcaaaacaaacctgaattaagtaggttaatagaatcaggtattagattgatttaa

DBGET integrated database retrieval system