KEGG   Formosa sp. Hel3_A1_48: FORMA_15090Help
Entry
FORMA_15090       CDS       T04482                                 

Definition
(GenBank) glycoside hydrolase, GH30 family
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
foh  Formosa sp. Hel3_A1_48
Pathway
foh00511  Other glycan degradation
foh00600  Sphingolipid metabolism
foh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:foh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    FORMA_15090
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    FORMA_15090
Enzymes [BR:foh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     FORMA_15090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_cc Alpha-L-AF_C
Motif
Other DBs
NCBI-ProteinID: AOR26664
UniProt: A0A1D7XTK5
Position
1598383..1599825
Genome map
AA seq 480 aa AA seqDB search
MNACMNSTKENITVIETSKSGNQLTERTDFELGASPSLIKLNFDQKFQTISGFGGAFTEA
SAHLLNRMSQENRTAILEAYFSRKGANYSLTRTHMNSCDFSLSNYSYSPVAGDKNLEHFS
VQEDQLDLIPMIKGALATSEDGFRLFASPWTAAPWMKDNNDWVGGKLLPKYYDTWALFFS
KYVDAYKAEGIDIWGFTVENEPHGNGNNWESMHFTPEEMTDFVQNFLGPKLEADGKGDLI
ILGYDQNREGIKEWVDVMYNDEASSKYFDGTAIHWYESTYDFFPEALQYAHEKAPNKYLI
QTEACVDSEVPAWKDDNWYWEKKATDWGYDWREDNKKYLHPKYAPANRYARDIIGCLNNW
VDGWVDWNMVLDRQGGPNWFKNWCAAPIIVDPETDEVYYTPLYYIMAHFSKYIRPGAEVI
GVDSTDKDLMVAAAKNPDNSVAVVVFNEGMEQKYFELKTSTSTTQISISPQAIQTILITN
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcttgtatgaactctactaaggaaaatattactgttattgaaacttcaaagagc
ggaaaccaactgacggagcgcactgattttgaattaggggcttctccttctttaataaaa
ctaaattttgatcaaaaatttcaaacgatttcgggttttggaggtgcttttacagaagca
tcagcgcacttactgaatcgaatgagtcaagaaaataggaccgctatcttagaagcatac
tttagtcgaaaaggggcaaattattcactgacgcggacacacatgaattcgtgtgatttt
tccttgtcaaactattcatattctccagttgctggagataaaaatttagagcatttttct
gtgcaagaagatcaactcgatttgatccctatgatcaaaggcgcattagcaacttctgaa
gatggatttagattatttgcttcaccatggactgctgcgccttggatgaaagacaataat
gattgggtaggcggtaaattactgccaaagtattatgatacctgggccttatttttttcc
aaatatgtagatgcctacaaagctgagggtattgatatttggggctttacggtagaaaat
gaaccacacggaaatggcaacaactgggaaagtatgcattttaccccagaagaaatgacg
gattttgttcaaaattttctagggccaaaattagaagctgatggtaaaggggatttgatt
attcttggatacgatcaaaatcgtgaggggattaaagaatgggtagatgtgatgtacaat
gatgaagcgtcctcaaaatacttcgatggaacagcaatccattggtatgaaagcacctac
gacttttttcctgaggcacttcaatacgcacacgaaaaagcaccaaacaaatatttgata
caaactgaagcttgtgtggactctgaagttcctgcgtggaaagatgataattggtattgg
gagaaaaaagcaacagattggggctatgactggcgtgaggataacaaaaaataccttcat
cccaaatatgcccctgcaaatcgttatgcacgagatataattgggtgcctcaacaactgg
gtcgatggttgggtcgattggaatatggttttagatcgtcaaggaggaccaaattggttc
aagaattggtgtgctgctcctatcatcgtagatccagagaccgatgaggtatactatact
ccattgtattacattatggcccatttcagtaaatatatacgcccgggagcagaagtaata
ggggtagattcaaccgacaaagacttgatggttgccgcagccaaaaaccctgacaactct
gtagctgtagtggtttttaatgaagggatggagcaaaaatattttgaattaaaaacgtca
acttctaccacacaaatttcgattagtcctcaagcaattcaaacaattttgattactaac
taa

DBGET integrated database retrieval system