KEGG   Formosa sp. Hel3_A1_48: FORMA_15550Help
Entry
FORMA_15550       CDS       T04482                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
foh  Formosa sp. Hel3_A1_48
Pathway
foh00330  Arginine and proline metabolism
foh00360  Phenylalanine metabolism
foh00380  Tryptophan metabolism
foh00643  Styrene degradation
foh01100  Metabolic pathways
foh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:foh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    FORMA_15550
   00360 Phenylalanine metabolism
    FORMA_15550
   00380 Tryptophan metabolism
    FORMA_15550
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    FORMA_15550
   00643 Styrene degradation
    FORMA_15550
Enzymes [BR:foh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     FORMA_15550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AOR26705
UniProt: A0A1D7XTS0
Position
1642187..1643806
Genome map
AA seq 539 aa AA seqDB search
MNMKKGALFLLFFIFFGCKNQTHDPDDSLSDISEKSFRSFKVEDSNYIDLKQFWAPFQDE
LSIFSSDRYETLKPLVMNQDIPTLQKFIKQGKLRYEELTLFYLYRIKSFDRMNEKSLNSV
ISLNPNIIKDAKEKDLNRPENLSNFSIYGMPILLKDNINTYDMVTTAGAVALLKNHTDDA
FVSKQLKASGALILGKANLSEWAYFFCGDCPSGYSTVGGQTFNPYGRKTLDTGGSSSGSA
VAVAANFCAAAVGSETSGSILSPASQNAGVGLKPTIGAISRTGIVPISSTLDTAGPITKY
VIDNVLIFNGMIGKDRDDFKSKTVAAIDINVLQQSNFQGKRFGAIQSLLKDSLYTAAVNL
LKRNGAKVITITPEDVDLPDFLRLLNLDMKVDLPTYFKWHANTNLPYDGVQSIIDFNALD
SLKRAPYGQKLFIGIVADDATNKELESIKSILKTNGRAYFDSVMKFHQLDAVLSINNYHA
GYAAVAEYPALTVPMGLSDEGAPKGFTFIAKPHQEPELYAWGYQFEKAFEKRPTPNNYN
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgaaaaaaggggcgttatttttattgttttttattttttttggctgtaaaaat
cagactcatgacccagatgatagcttaagtgatatttctgaaaaatcatttcgatcgttt
aaggtagaagattctaattatatagatttaaagcagttttgggcaccatttcaagatgaa
ctttctattttctcatctgatcgttatgaaaccttaaagcctcttgtaatgaaccaagat
attccaacactacagaagtttattaaacaagggaaactcagatatgaagaattaacttta
ttctatttgtatcgtatcaaatcttttgataggatgaatgaaaaatcactaaattctgtg
atttctttgaaccccaacattattaaggatgccaaagaaaaagaccttaatagacctgaa
aatctttcaaatttttcaatttatgggatgccaattcttttgaaagataatatcaatacc
tatgatatggttactaccgctggtgctgtagccttgttgaagaaccacaccgatgatgcc
tttgtttcaaagcagcttaaggcatcaggggcactgattttaggaaaagctaatcttagt
gaatgggcttatttcttttgtggagactgcccaagtggttacagtacagtgggtggacaa
acgtttaacccttatggccgcaaaacactagatactggcggctcaagttctggaagtgct
gtagctgttgcagctaatttttgtgctgcagccgttggaagtgaaacatcaggatctata
ctttcgcctgccagtcaaaatgcaggtgtaggacttaaaccaaccattggagcgatcagc
cgaactggtatagttcctatctctagtacgttagatactgcgggtccaattacaaaatat
gtgattgataatgtattgatttttaatggaatgataggaaaagacagagatgactttaaa
tccaaaacagttgcagcaattgacattaacgtactgcaacaatctaactttcagggtaag
cgttttggtgcgattcaatcgctattgaaagattcactttacacagctgcggtaaacctt
ttgaagcgcaatggtgctaaagtgatcaccataacccctgaagatgttgatcttcctgat
tttttgagacttttgaatttggatatgaaagtcgatttaccaacttattttaaatggcat
gccaatacaaacttaccgtatgatggtgttcagtcaatcattgattttaatgccttagat
tcactaaaaagagctccttatggccaaaaattgtttataggtattgttgctgatgatgca
acaaacaaagaattagaatccatcaaatcaatactaaaaaccaatggccgcgcttatttc
gattcagtaatgaaatttcatcaattggatgcagttctttccataaataattaccacgct
ggttatgctgctgtagcagaatatccagcactcactgtgccaatgggcctctcagatgag
ggagctccaaaaggattcacttttatcgcaaaaccacatcaggaaccagaactttatgca
tggggttatcaatttgaaaaagcttttgaaaaacgacctacacccaataattacaactaa

DBGET integrated database retrieval system