KEGG   Formosa sp. PS13: FNB79_07520Help
Entry
FNB79_07520       CDS       T06103                                 

Definition
(GenBank) phosphatidylserine decarboxylase family protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
fop  Formosa sp. PS13
Pathway
fop00564  Glycerophospholipid metabolism
fop01100  Metabolic pathways
fop01110  Biosynthesis of secondary metabolites
Module
fop_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:fop00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FNB79_07520
Enzymes [BR:fop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     FNB79_07520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase DUF4131 CsgF PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: QDO93834
UniProt: A0A516GQN0
Position
complement(1715968..1716618)
Genome map
AA seq 216 aa AA seqDB search
MFHKEGFKIILIAFALVVASFLVIDNFISFVWLRNILFFSCLAFLILILQFFRNPKRNGI
LNDNQVLSPVDGKVVVIEEVFEKEYFKEKRLQVSVFMSPINVHVTRYPIGGKVVFSKYHP
GKFLVAWHPKASEENERTTVVVENEIFGKVLHRQIAGALAKRIVNYAKVGDQAIQASDSG
FIKFGSRVDLFLPLGTKINVNLNDKVKGGESIIAEL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtttcataaagaaggttttaagatcatactaatcgcttttgcactagtagttgcatca
tttttagtgatagacaattttatatctttcgtctggttacgaaacatattatttttctct
tgcctagcatttctaatattaattttacaattttttagaaatccaaaacgtaatggtatt
ttaaatgacaatcaagttttatctcctgtagacgggaaagtagttgttatagaagaagtt
tttgaaaaggaatactttaaagaaaagcgtttacaagttagtgtatttatgtctccaata
aatgtacacgttacaagatatcctataggcggaaaagtcgtgtttagcaaataccaccca
ggtaaatttttagtcgcttggcacccaaaagctagtgaagaaaacgagcgtactactgtt
gttgtagaaaacgaaatctttggaaaagttttacacagacaaattgcaggcgcattagct
aaacgtatagtaaattatgccaaagttggagaccaagctatacaagcgagtgattcaggc
tttattaaatttgggtcaagagtagatttatttttacctttgggaactaaaattaatgta
aaccttaacgacaaagttaaaggtggggaaagtattattgccgaattataa

DBGET integrated database retrieval system