KEGG   Formosa sp. Hel1_33_131: FORMB_05710Help
Entry
FORMB_05710       CDS       T04465                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
for  Formosa sp. Hel1_33_131
Pathway
for00564  Glycerophospholipid metabolism
for01100  Metabolic pathways
for01110  Biosynthesis of secondary metabolites
Module
for_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:for00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FORMB_05710
Enzymes [BR:for01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     FORMB_05710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Cpta_toxin DUF4131 PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AOR27624
UniProt: A0A1D7XWC6
Position
633043..633690
Genome map
AA seq 215 aa AA seqDB search
MFHKEGQKIIFVALVFVVATSLLIDNLQMPWVSKLIQFSLIVILVLILQFFRNPKRHTHQ
NDRQVIAPVDGKVVVIEEVEETEYFKEKRLQVSIFMSPINVHVTRYPISGSVLFSKYHPG
KYLVAWHPKASTDNERTTIVVENKTYGKVLYRQIAGALARRIVNYAKEGQTVVQGTDAGF
IKFGSRVDLFLPLDTKLKVKLNQKVKGGECIIAEV
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtttcataaagaaggtcaaaaaataatttttgtcgcactcgtttttgtagtggctaca
tcgttattaatcgacaatttacaaatgccttgggtttcaaaactcattcagttctcttta
atagtgattcttgtactcatcctacaatttttcagaaaccctaaacgtcacacccatcaa
aacgatcgtcaagtgatcgcccctgtagatgggaaagttgtggtgatcgaagaggttgaa
gaaacagaatatttcaaagaaaaacgtcttcaggtcagcatttttatgtcgcctatcaat
gtgcatgtgacacgctaccctataagtggttcggtactttttagcaaataccacccagga
aagtatttagtcgcatggcatccaaaggctagtacggataacgaacgcaccaccatagtt
gttgagaataaaacctatggtaaagtcctttacagacagatcgcaggtgccttggcaaga
cgtattgtcaattatgcgaaagaaggccaaacggttgtacagggtaccgatgctggattt
ataaaatttggttctagagtcgatttatttttacctttggacaccaaacttaaagtcaaa
ctcaatcaaaaagtaaaaggcggcgaatgtatcatcgcagaagtatag

DBGET integrated database retrieval system