KEGG   Formosa sp. Hel1_33_131: FORMB_06210Help
Entry
FORMB_06210       CDS       T04465                                 

Definition
(GenBank) cobalt transporter
  KO
K06195  ApaG protein
Organism
for  Formosa sp. Hel1_33_131
Brite
KEGG Orthology (KO) [BR:for00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    FORMB_06210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AOR27674
UniProt: A0A1D7XWI1
Position
678553..678939
Genome map
AA seq 128 aa AA seqDB search
MIEQITKGIKISIETEFEGTFYKEECIHYAFSYEIMIENQSHEIAQLIARKWTIMEALNE
NEVVTGEGVVGEKPILLPGDRHNYTSGCVLKSPFGAMKGSYLMVNPSNSKQFKVTIPTFK
LSASFAQN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgatagaacaaatcaccaaaggcataaaaatttcgattgaaactgagtttgaaggaacc
ttctacaaagaggaatgtattcattatgcgtttagctatgaaatcatgattgaaaatcag
agtcatgagatcgcccaactgatcgcaagaaaatggactatcatggaagccctgaatgaa
aatgaagtcgtcaccggcgaaggcgttgttggcgaaaaacccattcttcttcctggcgat
cgccataactacacttctggatgtgttttaaaatcgccctttggtgctatgaaaggcagc
tatttaatggtgaacccttccaactcaaaacagttcaaagtgaccattccaacttttaaa
ttaagtgcctcatttgcacaaaattaa

DBGET integrated database retrieval system