KEGG   Formosa sp. Hel1_33_131: FORMB_20520Help
Entry
FORMB_20520       CDS       T04465                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
for  Formosa sp. Hel1_33_131
Pathway
for00860  Porphyrin and chlorophyll metabolism
for01100  Metabolic pathways
for01110  Biosynthesis of secondary metabolites
for01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:for00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FORMB_20520
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:for01007]
    FORMB_20520
Enzymes [BR:for01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     FORMB_20520
Amino acid related enzymes [BR:for01007]
 Aminotransferase (transaminase)
  Class III
   FORMB_20520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOR29080
UniProt: A0A1D7Y0X7
Position
2127096..2128382
Genome map
AA seq 428 aa AA seqDB search
MKYQRSSQLFRAASEVIPGGVNSPVRAFKAVGGTPIFVNKAKGAYLYDADGNRLIDYINS
WGPMVLGHAFPPVIEAVIEKAQLGTSFGMPTEIETKIAELAVSMVPNIDQIRFVNSGTEA
CMSAVRLARGFSGKEKIIKFAGCYHGHSDSFLIQAGSGAVTFGSPNSPGVTEGTAKDTLL
APYNNLEAVAAIFEANPSEIACIIVEPVAGNMGCIPPDSGFLEGLRALCDAHGSVLVFDE
VMTGFRLARGGVQELYGVNADIVCFGKVIGGGLPVGAFAARHEIMSHLAPLGPVYQAGTL
SGNPLAMAAGYAMLQALESDAEVFERLAQKTEYLHKGIAASLTAHNITHTINRIGSMISI
HFSETPVVDFETAAEGNNERFKTFFHGLLDAGIYIAPSAFETWFITDALTYEDLDETIAA
VTKIAPNL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaataccaacgcagtagtcaattattcagagccgcttcggaggtgattccggggggt
gttaattctccagtacgtgcttttaaagccgttggtggaacgcctatttttgtaaacaaa
gcgaagggtgcttatttgtatgatgccgatggcaaccgacttattgattatatcaattct
tgggggccgatggttttggggcatgcatttccacctgtcattgaggcggtcatagagaaa
gcccaattgggaacttcttttggaatgcctacagaaattgaaactaaaatagcggaattg
gcagtgtcaatggtgcccaatattgatcaaattcgatttgtgaattcaggaactgaggcc
tgtatgagtgccgtgcgtttggcgcgtggattctcaggaaaagaaaaaatcatcaaattt
gcaggctgttaccatggtcattcagattcttttttgattcaagcggggagtggtgcggtt
acttttggaagtcctaacagtccaggggtgacggaaggcactgccaaagacacgcttcta
gcaccttataataatttagaagccgttgctgctatttttgaggccaacccttctgaaatc
gcgtgtatcattgtggaacctgttgcaggaaatatgggttgtattccgccagattcggga
tttttagaaggtcttcgtgccttgtgtgatgcacatggttctgttttagtatttgatgag
gtgatgaccggttttcgtttggcacgcggtggggttcaagaactgtatggcgtgaatgcg
gatattgtgtgttttggaaaagtgattgggggtggattgcccgttggtgcttttgcagca
cgccacgaaattatgagtcatttagctcctttaggtcctgtgtatcaagcaggaactttg
agtgggaatcccttagctatggcggcaggttatgccatgttgcaggctttagagtctgat
gcggaagtttttgaacgcttagctcagaaaacagaatacttacataaagggattgcagcg
agtttaacggctcataacatcacacatacaattaaccgaataggatctatgatttcgatt
catttttctgaaactccagtggtcgattttgaaacggctgcagaaggaaacaatgaacgt
tttaaaaccttttttcatgggcttcttgacgcgggaatttatattgcacccagtgctttt
gaaacctggtttattacagatgcattaacctacgaagatttggacgaaacgattgcggcg
gttaccaaaattgctccgaacttataa

DBGET integrated database retrieval system