KEGG   Fusarium oxysporum: FOXG_00893Help
Entry
FOXG_00893        CDS       T04882                                 

Definition
(RefSeq) heat shock protein SSB1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
fox  Fusarium oxysporum
Pathway
fox03040  Spliceosome
fox04141  Protein processing in endoplasmic reticulum
fox04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:fox00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    FOXG_00893
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    FOXG_00893
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    FOXG_00893
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fox01009]
    FOXG_00893
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:fox03041]
    FOXG_00893
   03009 Ribosome biogenesis [BR:fox03009]
    FOXG_00893
   03110 Chaperones and folding catalysts [BR:fox03110]
    FOXG_00893
   04131 Membrane trafficking [BR:fox04131]
    FOXG_00893
   03051 Proteasome [BR:fox03051]
    FOXG_00893
   03029 Mitochondrial biogenesis [BR:fox03029]
    FOXG_00893
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fox04147]
    FOXG_00893
Protein phosphatases and associated proteins [BR:fox01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     FOXG_00893
Spliceosome [BR:fox03041]
 Complex B
  Other components
   Prp19 complex
    FOXG_00893
 Complex C
   Prp19-CDC5 complex
    FOXG_00893
Ribosome biogenesis [BR:fox03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    FOXG_00893
Chaperones and folding catalysts [BR:fox03110]
 Heat shock proteins
  HSP70 / DNAK
   FOXG_00893
Membrane trafficking [BR:fox04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    FOXG_00893
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    FOXG_00893
Proteasome [BR:fox03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    FOXG_00893
Mitochondrial biogenesis [BR:fox03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    FOXG_00893
Exosome [BR:fox04147]
 Exosomal proteins
  Proteins found in most exosomes
   FOXG_00893
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR
Motif
Other DBs
NCBI-GeneID: 28943180
NCBI-ProteinID: XP_018233273
UniProt: A0A0D2XAH7
Position
1
AA seq 614 aa AA seqDB search
MADEVYDGAIGIDLGTTYSCVATYEGTNVEIIANEQGSFTTPSFVSFTDKERLIGEAAKN
NAAMNPRNTVFDAKRLIGRRFDDPTVKKDIESWPFKIVDDNGSPKIEVEYLGENKQFSAQ
EISSMVLTKMKEIAETKLGKKVEKAVITVPAYFNDNQRQATKDAGSIAGLNVLRIINEPT
AAAIAYGLGAGKSEKERNVLIYDLGGGTFDVSLLNIQGGVFTVKATAGDTHLGGQDFDTN
LLDHCKKEFGRKTKKDLSGDARALRRLRTACERAKRTLSSGAQATIEIDSLFDGEDFTMS
ITRARFEDLNAKAFSGTIEPVAQVLKDAQIEKKAVDEIVLVGGSTRIPKIQKLLSEFFDG
KKLEKSINPDEAVAYGAAVQAGILSGKATSAETSDLLLLDVVPLSLGVAMEGNIFAPVVP
RGTTCPTLKKRTFTTVADNQQTVQFPVYQGERVNCEDNTSLGEFTLAPIPPMRAGEAVLE
CVFEVDVNGILKVTATEKTSGRSANITISNSVGKLTTDEIEKMVNDAEQFKSNDDAFQKK
FEAKQQLESYIGRVEEIVSDPTLSLKLKRGQKEKIESTISDAMAALELNESSAEDLKKQE
LALKRLVTKAMSSR
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaagtgtatgacggtgccattggcattgatctgggtactacctactcctgt
gttgctacctacgagggtaccaatgtcgagatcatcgccaacgagcagggttctttcacc
accccttctttcgtttccttcactgataaggagcgtctgatcggtgaggccgccaagaac
aacgctgccatgaacccccgcaacactgtcttcgatgccaagcgtctgattggtcgtcgt
ttcgatgaccctaccgtcaagaaggacatcgagtcttggcccttcaagattgtcgatgac
aacggcagccccaagatcgaggtcgagtacctcggcgagaacaagcagttctctgcccag
gaaatctcctccatggtcctcaccaagatgaaggagattgccgagaccaagctcggcaag
aaggtcgagaaagccgtcatcactgtccctgcctacttcaacgacaaccagcgtcaggcc
accaaggacgccggttccattgccggtctcaacgtcctccgtatcattaacgagcctact
gccgccgccattgcctacggtcttggtgccggtaagtctgagaaggagcgcaacgttctc
atctacgatctcggtggtggtactttcgatgtctccctcctcaacatccagggtggtgtc
ttcaccgtcaaggctaccgctggtgatacccacttgggtggacaggatttcgacaccaac
ctcctcgaccactgcaagaaggagttcggccgaaagacgaagaaggacctctctggcgat
gcccgtgccctccgacgtctccgaactgcttgtgagcgtgccaagcgtactctctccagc
ggtgcccaggccaccattgagattgactctctcttcgacggtgaggacttcaccatgtcc
atcacccgcgcccgtttcgaggaccttaacgccaaggctttctctggcaccattgagccc
gttgctcaggttctcaaggatgcccagattgagaagaaggccgttgacgagatcgtcctc
gtcggtggttccacccgtatccccaagatccagaagcttctctccgagttcttcgacggt
aagaagctcgagaagagcatcaaccccgatgaggccgtcgcatacggcgctgccgtccag
gccggaattttgtctggaaaggctacctccgctgagacctccgacctcctcctcctcgat
gtcgttcccctgtccctgggtgttgccatggagggtaacatcttcgcccccgttgttccc
cgtggtactacttgccctaccctgaagaagcgaacattcactacagttgccgataaccag
cagactgttcagttccccgtctaccaaggcgagcgcgtgaactgcgaggacaacacctcc
ctcggagagttcactcttgcccctatccctcccatgcgtgctggcgaggccgtcctcgag
tgtgtcttcgaggtcgacgtcaacggtatccttaaggtcactgctaccgagaagacctcg
ggtcgcagcgccaatatcaccatctccaactctgtcggcaagctcaccaccgacgagatc
gagaagatggtcaacgacgctgagcagttcaagagcaacgacgacgctttccagaagaag
ttcgaggccaagcagcaactcgagtcctacatcggccgtgttgaggagatcgtctctgac
cccactctgtcccttaagcttaagcgtggccagaaggagaagatcgagagcactatcagc
gacgccatggctgctcttgagctcaacgagtcttctgctgaggacctcaagaagcaggag
cttgccctcaagcgccttgtcaccaaggctatgtcttcccgataa

DBGET integrated database retrieval system