KEGG   Fusarium oxysporum: FOXG_02348
Entry
FOXG_02348        CDS       T04882                                 

Definition
(RefSeq) Delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
fox  Fusarium oxysporum
Pathway
fox00100  Steroid biosynthesis
fox01100  Metabolic pathways
fox01110  Biosynthesis of secondary metabolites
Module
fox_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    FOXG_02348
Enzymes [BR:fox01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     FOXG_02348
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 28944549
NCBI-ProteinID: XP_018235877
UniProt: A0A0D2XEL3
Position
5
AA seq 485 aa
MAVKDKQPASEEQHGYEFFGPPGAFVISFFLPILVYVFNFVCNDISGCPAPSLLHPKTLS
LDALKHEVGWPSNGVAGLVSWKGTAAVIGYNVLSLILYRVLPAVEVEGTELRSGGKLKYR
FNTLYSSTFTLAVLAAGTAAQGAEFPVWTFMSENFIQILSANIIYSYLVSTFVYVRSFSV
KPGNKENRELAAGGHSGNMLYDWFIGRELNPRISIPLIGEVDIKEFLELRPGMMGWIIMN
CSWCAQQYRNYGFVTDSSILITAVQALYVFDSWWNEPAILTTMDITTDGFGMMLAFGDIV
WVPYVYSLQTRYLSVHPVSLGPLGLAGMLGLIGLGFYIFRSANNEKNRFRTNPDDPRISH
LKYIQTQKGSKLLTTGWWGIARHINYLGDWIQSWPYCLPTGIAGYQILSAGTHAEGAWVM
RDGREVIRGEAKGWGMLITYFYILYFAILLIHRERRDDDKCHRKYGKDWEEYRKIVRYRI
IPGIY
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggctgtcaaagataaacagccggcttcagaggagcaacacggctatgagttctttggc
cctcccggcgcctttgtcatctcgttcttcctccccatcctcgtatacgtcttcaacttc
gtctgcaacgacatctcgggatgccccgcgccatctctgcttcaccccaagaccctatcg
ctcgatgccttgaaacacgaagtcggatggcccagcaatggcgtcgctggcctggtcagc
tggaagggaaccgccgctgtgatcggatacaatgtcctctccctgatcctctaccgggtt
cttcccgcggttgaagttgagggcaccgagttgcgctctggaggaaaactcaagtaccga
tttaacactttgtactctagcaccttcaccctggctgtccttgccgctggaaccgctgct
cagggtgccgagtttccggtctggaccttcatgtcggagaacttcattcagatcctttcc
gccaacatcatctactcctacctcgtgtccaccttcgtctacgttcgaagctttagcgtt
aagcccggaaataaggagaaccgcgagcttgctgctggaggccactccggaaacatgttg
tatgattggttcatcggtcgtgaactgaacccccgtatttcgatccctctcatcggtgag
gttgacatcaaggagttccttgagcttcgacctggaatgatgggctggattatcatgaac
tgttcttggtgcgctcagcagtatcgcaactatggtttcgtgacggatagctctatcctc
atcaccgctgttcaggctctgtatgtcttcgactcttggtggaacgagcccgcgatcttg
acgaccatggacatcaccaccgacggcttcggtatgatgttggcttttggcgatattgtt
tgggtgccatatgtctactcgctgcagacccgatatctctccgttcaccctgtctctctc
ggccctctcggactagccggtatgctgggtctcatcggccttggcttctacatcttccgc
tcagccaacaacgagaagaaccgcttccgaaccaaccccgacgatcccagaatctctcac
ctcaagtacatccagacccagaagggcagcaagcttctcacaacaggctggtggggaatc
gctcgtcacatcaactacctgggcgattggatccagtcgtggccctactgtcttcccacc
ggtatcgccgggtatcagattctcagcgccggaactcatgccgagggcgcgtgggttatg
cgagacggtcgagaggttatccggggcgaagctaagggatggggcatgctcatcacctac
ttctacatcctgtactttgctatcctcctcattcaccgtgagagacgtgacgacgacaag
tgccatcgcaagtacggcaaggactgggaggagtaccgcaagattgttcgataccgaatc
atccctggtatctactga

DBGET integrated database retrieval system