KEGG   Fusarium oxysporum: FOXG_03094Help
Entry
FOXG_03094        CDS       T04882                                 

Definition
(RefSeq) aspartyl-tRNA synthetase
  KO
K22503  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
fox  Fusarium oxysporum
Pathway
fox00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:fox00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FOXG_03094
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fox01007]
    FOXG_03094
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fox03016]
    FOXG_03094
Enzymes [BR:fox01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     FOXG_03094
Amino acid related enzymes [BR:fox01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   FOXG_03094
Transfer RNA biogenesis [BR:fox03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    FOXG_03094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon NARP1
Motif
Other DBs
NCBI-GeneID: 28945239
NCBI-ProteinID: XP_018236930
UniProt: A0A0J9UI89
Position
8
AA seq 494 aa AA seqDB search
MADAPAEQAAAPPPAEQAPAVSGEAVEGGEAGPSKKALKKAEAKAKKEAEKARRAAEHEA
RQSAAKAAAGNTEDLAKDNYGDSTHLTKIDAERVKLRNLSDEHLGKTIKLRAWIQNARMQ
GAKMAFVELREERDWAIQGVVAASSEGTPVSKQMVKWIGSLNLEGYILVEAKVVKPQEPV
KSVKVSNYELHISKCYVISPGPQVLGMGLAVANRPVTNFDDEDAGGPVEEVKEGVDNLSL
ENVPGASMATHLNNPVMHKRAPVQQAIADFTGLDLEMEIEDHYHEVRDMLEGVLLHIFRG
LQERCAEQIALVRTVYPSEDFLLPKPGKEVRLTFAEGQALLRAEGPEEYRNVSDEEDMST
PQEKALGALIREKYSTDFYVLDKFPEGARPFYALEDPENPKVTNAFDFFMRGQEILSGGQ
RIHVPETLEARIRTKGIDPKSQGIKEYVDIFRSAGVPPHGGGGIGLDRVVAWYLNLPSVH
LASYYPRTPKRLLP
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgcccctgctgagcaagctgctgccccccctcccgccgaacaggctcccgcc
gttagtggtgaagccgtcgagggcggagaggctggcccctcaaagaaggcattgaagaag
gctgaggcgaaggctaagaaggaagctgagaaggcacgccgagctgctgaacacgaagcc
cgacagtctgctgcaaaggctgctgctggaaataccgaagacctcgctaaagacaactat
ggagattccactcatcttaccaagatcgatgcggagcgagtcaagctccgaaacctgagc
gatgagcatctcggcaagaccatcaagcttcgtgcgtggatccagaatgcgcgcatgcaa
ggtgctaagatggcctttgttgagcttcgcgaggagcgtgactgggctatccagggcgtc
gtcgcggccagcagtgaaggcacacctgtctctaagcagatggtcaagtggatcggtagt
ctaaatctagaaggctacattcttgtcgaagctaaggttgtgaagccccaagagccagtc
aagagcgtgaaggtctccaattacgagctacatatctctaagtgctacgttatcagccct
ggccctcaagttcttggcatgggtcttgctgttgccaaccggcctgttaccaactttgac
gatgaagacgctggtggccctgtcgaggaggtcaaggaaggcgttgacaatttaagcctt
gagaacgtccctggtgccagcatggcaactcatttgaacaaccccgttatgcacaagcga
gctcctgttcagcaagccatagccgatttcaccggtcttgatcttgagatggaaatcgag
gaccattaccacgaggtccgcgacatgctcgagggggttcttcttcatatcttccgaggg
cttcaggagcgatgtgccgagcagattgctcttgttcgaacggtttacccttctgaggac
tttcttttgcccaagcccggtaaggaggttcgccttacattcgctgagggtcaggcactc
cttagagctgagggtccggaggagtaccgcaacgtctctgatgaagaggacatgagcaca
ccgcaagagaaggcactaggcgctcttatccgggaaaagtacagcaccgacttctacgtc
cttgacaagttccccgagggtgctcgacctttctatgccctggaggaccccgagaatccc
aaggttactaatgccttcgatttctttatgcgtggacaagagattctatctggtggtcaa
cgtattcacgttccggagactctggaagcacgaattcgtacaaagggtatcgaccctaaa
agccaaggcatcaaggagtatgtcgacattttccgcagtgccggtgttccccctcacggc
ggcggtggtattggcttggaccgtgtggttgcgtggtatttgaaccttccaagcgtgcac
ttggcaagctattatcctcgtacacccaagagactcttgccttaa

DBGET integrated database retrieval system