KEGG   Fusarium oxysporum: FOXG_03197Help
Entry
FOXG_03197        CDS       T04882                                 

Definition
(RefSeq) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
fox  Fusarium oxysporum
Pathway
fox00520  Amino sugar and nucleotide sugar metabolism
fox01100  Metabolic pathways
fox01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FOXG_03197
Enzymes [BR:fox01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     FOXG_03197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 28945333
NCBI-ProteinID: XP_018237162
UniProt: A0A0J9WIU0
Position
8
AA seq 434 aa AA seqDB search
MPIAVSPTLPKNGLTKFTNCRLLKGNDLVWEDLWVSSITGKIIDSQASFYGGRNMPDNTL
DLGGRIIAPGLIECQLNGAFGFNFSTLLDDMSEYGKNIQKINRLLVKTGVTSYIPTITSQ
RPELYQKALPYLGPSGELRILSYRSRIRPTKNGVHNVDVLTQAESIEDIEQCYGRENITP
RSDGAPMPIKMITAAPERGQMMNLIPEITSRGIIYSVGHTEATYEETSQAVSKGATMITH
LFNAMRPLHHRNPGVFGVLGKAESLPRPYFGIISDGIHLHPTTIKIAYSAHPDGFILVTD
AMHLVGLPDGAYPWTNGEYTCNIVKQGSKLLLENSDTIAGSSITLLECVNNFRQWTGASI
PQALGAVTSTPAAMLGLQGVKGSLESGADADLVILSDGYERQDEVRGTNEVLVLDEVWKF
GERVSDSAKESKLM
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcgccgtctcgccgaccctacccaagaatggcctcactaagttcaccaactgt
cggttgctgaagggcaacgacttggtctgggaggacctttgggtcagctccattactggc
aagatcatcgatagccaggcttcattctatggcggccgcaacatgcctgacaatactctt
gaccttggcggacgcatcattgcaccaggtctgatcgagtgccagctcaacggtgccttt
ggcttcaacttctcaaccttactggatgacatgtccgaatatggcaaaaacatccaaaag
atcaatcggctactggtcaagacaggggtcacatcgtacatcccaaccatcaccagtcaa
cggcctgaattataccaaaaggccctcccgtatcttggcccgtctggggaactgcggatc
ctatcataccgtagcagaattcgtcccaccaagaatggagttcacaatgtcgatgtcctc
acacaagctgaatcgatagaggacattgagcaatgttatggtcgtgagaatataacccct
cgctccgatggcgcgccaatgccgatcaagatgattacagcagcgccggaacgcggacag
atgatgaacctaatcccagagatcacatcaagaggaatcatatattcagttggccacacc
gaggcaacatatgaagagacatcgcaagctgttagtaagggtgctacaatgattacacac
ctcttcaatgccatgcgtccattgcatcacagaaacccaggtgtctttggagttttgggc
aaggctgagagtctgccacgaccttactttggcatcatctcagatggcattcatttgcat
cctacgactatcaaaatcgcctacagcgctcatcctgatggctttatcctggtcacggat
gctatgcatcttgttggtctcccggatggggcctatccgtggacaaacggagaatacaca
tgcaacattgtcaagcaaggttctaaattgctcctcgagaactctgacacgattgctggg
agctcaattactctcctcgagtgtgtcaataatttcagacagtggactggggctagtatt
ccccaggcccttggagcggtcacatcaacacccgcagccatgcttggcttacagggagtc
aagggttcactagaatcgggggctgacgcagatctggtgattttgtcagacggatacgaa
agacaggacgaggtcaggggaacgaatgaagttctcgtgctggacgaagtgtggaagttt
ggtgagagggtgtctgactctgccaaggagagcaagttgatgtga

DBGET integrated database retrieval system