KEGG   Fusarium oxysporum: FOXG_03331Help
Entry
FOXG_03331        CDS       T04882                                 

Definition
(RefSeq) hypothetical protein
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
fox  Fusarium oxysporum
Brite
KEGG Orthology (KO) [BR:fox00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fox03016]
    FOXG_03331
Enzymes [BR:fox01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     FOXG_03331
Transfer RNA biogenesis [BR:fox03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    FOXG_03331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3
Motif
Other DBs
NCBI-GeneID: 28945461
NCBI-ProteinID: XP_018237414
UniProt: A0A0D2XHD3
Position
8
AA seq 310 aa AA seqDB search
MQELASSPPAFVERKKKILEQLAIPDTEYTDASPKGSIDEGIRDLIDEINQQSGFVTTSS
CAGRVSVFLEGRRVADTEGEDEQVAGVGGKGAGGAWLFVSHDPVPDKSGSTDWSSLFGLQ
KSTEAQETTGEPKERRLVHFKYEAMILHVLTASPEHAQLLLRCGLQAGFRESGALNIIPN
GKDAATPMVAIRTMGLAFESLIGQQVDGHRQRIVSPEYLQTLVQIANERYIENKKRIERF
QNAFRDAISAPVPRLNPEGQEWEDAAARRERKRAEGLRKKAELKVKQETEPESDRAKSGK
EEDAGLLFEI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaactcgcttcttctccgcccgcttttgttgaaagaaagaaaaagattctcgaa
caactggcaattccagatacagaatacacggatgcttcaccgaaaggctctatagatgag
ggcatcagggatctcattgatgaaattaaccaacaatccggatttgtcactactagcagc
tgtgcaggccgtgtcagcgtttttcttgaagggcggagagttgctgacactgaaggagaa
gatgaacaggtagcaggtgttggtggaaaaggcgctgggggagcttggctgttcgtttcc
catgatccagtacctgacaagagtggaagtacagactggagcagtttatttggactccag
aaatctacagaggcacaggagacaaccggagaaccgaaagagagaagacttgttcacttc
aagtacgaggcaatgatcctccacgtcctcacagcatcaccggaacatgctcaactactt
ctgcgctgcggcctacaggcagggtttcgtgagtcgggtgccctcaatatcatcccgaat
ggcaaggatgctgccactcctatggtggctatacggacaatgggacttgcctttgagtct
ctcatcgggcagcaagttgacggccatcggcaacgcatagtctcacccgagtacctccag
accctcgtccagattgccaatgagcggtatatcgagaataagaagcgcattgaacgcttc
caaaacgccttcagagacgctatctctgctccagtaccacgtctaaaccctgaaggacaa
gaatgggaggacgctgcagcgagaagagaaaggaagcgtgctgagggcctgcgaaagaaa
gccgagctgaaagtcaagcaagagacagaaccagaatcagaccgcgccaaatcaggaaag
gaggaagacgcaggactactctttgagatataa

DBGET integrated database retrieval system