KEGG   Fusarium oxysporum: FOXG_03787Help
Entry
FOXG_03787        CDS       T04882                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
fox  Fusarium oxysporum
Pathway
fox00020  Citrate cycle (TCA cycle)
fox00640  Propanoate metabolism
fox01100  Metabolic pathways
fox01110  Biosynthesis of secondary metabolites
fox01130  Biosynthesis of antibiotics
fox01200  Carbon metabolism
Module
fox_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fox_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FOXG_03787
   00640 Propanoate metabolism
    FOXG_03787
Enzymes [BR:fox01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     FOXG_03787
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     FOXG_03787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 NTPase_1
Motif
Other DBs
NCBI-GeneID: 28945889
NCBI-ProteinID: XP_018238185
UniProt: A0A0J9ULL0
Position
4
AA seq 338 aa AA seqDB search
MIGLRFLHHVRSTTHLLRTAKCFSTSSAHSSPYDRTIRNLKITDQTRVIYQGFTGKAATK
NAQDTIEYGTKVVGGVSPGKGGQPHLDLPVFNTVKEAMEEVKPDVSAVFVPATFAAAAIL
EAIEAEIPLVVSVAEHVPVHDMLRVHEVLRTQSKTRLVGPNCPGIIAPNQCRVGIMPYKQ
YTRGCVGIVSKSGTLSYEAVGSTSRAGLGQSIVVGMGGDMLPGTTLADGLKLFFSHDETK
GIIVIGEIGGEAELEAAELIREHRRTFPKPKPVIAMVAGRTAPEGKAMGHAGAIWRNGDV
TAEAKSKALEDAGAIIVPHPGVMGEKMKELLGMKVFLH
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgataggtttgcggtttcttcatcatgttcgttctacgacacaccttctcaggacagcg
aaatgcttctctacctcatcagcgcacagcagtccatacgatagaacaatacggaacctc
aaaataacagaccagactcgagttatataccaaggcttcacaggcaaagccgcaaccaaa
aatgcacaagacacaatagaatatggaacaaaggtcgtcggaggcgtctctccaggcaaa
ggtggccagccacacctagaccttccagtcttcaacaccgtcaaagaggcgatggaggaa
gtcaaacccgacgtcagcgccgtatttgttcccgcaacattcgcagctgcagctattctc
gaagcaattgaagcagagattcctcttgttgtctctgtagcagagcacgtacccgttcac
gatatgcttcgggttcatgaggtcttgagaacacagtcgaagacacggctggtgggtccc
aattgtcctggtatcatcgccccaaaccagtgtcgcgtaggcatcatgccctacaagcag
tatactcgcggctgtgttgggatagtgtccaaatcaggtacattgagttacgaagctgtc
ggatcaacttcacgggctggcctgggacagagtatcgttgtaggcatgggaggcgacatg
ctaccaggcacgaccctggccgatggactgaagctcttcttcagccatgatgaaaccaag
ggaatcatcgtaattggagagatcgggggtgaggcagagctcgaggccgcggagctcatt
agagagcaccgtcgcacattccctaaaccgaagcctgtcatagcgatggtagcaggacgc
acagcgcctgaaggaaaggctatgggacatgccggtgcgatctggagaaacggagatgtt
actgcggaggcgaaaagtaaagctctcgaagatgcgggagctatcatcgtgccgcaccct
ggtgttatgggtgaaaagatgaaggagttgcttgggatgaaggtgtttcttcattag

DBGET integrated database retrieval system