KEGG   Fusarium oxysporum: FOXG_04133Help
Entry
FOXG_04133        CDS       T04882                                 

Definition
(RefSeq) hypothetical protein
Organism
fox  Fusarium oxysporum
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3 NACHT AAA_16
Motif
Other DBs
NCBI-GeneID: 28946198
NCBI-ProteinID: XP_018238660
UniProt: A0A0D2XJM3
Position
4
AA seq 2073 aa AA seqDB search
MSKSANTADEYDFVDHQDTALSPESVAELREWLQPTDYLAESSEYRRHLLSQAPGTGLWI
CETEEYRKWHDSPDHGSLWIKGVPGAGKSVMTASLIQHLRTTENCPVLFFFFRNIVAANF
SPRALIQDWLAQLLPHSPKLQFALQSRLQDSLDDTSDNELIQLFIDGVTCVPKLYCVGDA
LDEMSTDSTPILERLNGLATHRPRTLKLLMTSRPSRTLQSTLRDSSIVHVSLQQRLVDVD
IHSYLNHRFDNAPTLEHHREAKKDLINMVAEKSEGLFLYAKLTMDQVEESLQTDAALNIK
DLEASLPVGLEQTYTSMLAKQRGEPGVTTDVQVLILEAVIHASRPLRLNELASLLKCVRP
DTTQPSAFKSLIATSCGPLIEILEDETLQVIHHSFTEFLRGDTRSASTVGASDFPIIDSL
QAHKHMAMNCLVYLQSGSLLLESEQSNNSTVDPSVTFETPRHKIDHDAWHYRHEHLGLRD
EHDAFEYRPARLRHQFLSYAVENWPYHASNYDVDDDEFFKTIMDFLNSNSLSFLRWLVLQ
WGSTSSDKGSLKGIPTGLHLAAFAGLTHFASQLLKQGVSVSAVDAQERVPLHWAAANGHH
KVAALLIQYGANPDAEDGRGLKPIHLATLKNYAKVMTVLLEAGVKPNTIKTRENRTGRLL
GGERITKGECSIYYASRGGHTEAITVMIPFCEPQMLEQLLCQCCQFGRADAVQAILNNSP
VSPNATYEGATALYFACAMPDVKCVEALIRAGADVNKTSQWQPRRRMNGPRPQKREDATP
LHHLVEAWEDKNDSDSQEVLRMLLKAGADLERFDGHGRTPLIISAQDPRYSNETRNHLPA
LRALVRAGANVKVLGQPPSTDTMLHQVLEHSRDLEVVKLLVEYGCDPMQKNENGETALKR
AVSHTSSYKPECDSRKMDIVKYLLDQGADPCCKDKYGRTPVGAAMSHGPDLFKVLFERST
DTSVRQHCWFNLSSISDVGKFTHYLELLLSEGIDMEMVDSDGKTLYLNCLGYGKERLLIL
KDHGARTDVRDSNGNNALHRLCFYENRRTEEMKMLIDDGIDPLAINNNGDTLLHLVAKRY
DGTRETADLLGWLLSFGIPVNAVNNHGATPLHVFQTRRRTGSTLLDNKRTHFLDVLNRTG
EVDPQIRDNDGLSPLHLAVMRSEVEMSELKKLGLDLNFLTSDLQNVLHLACRARKASLVA
QILETVPNIDMNQEDQFGRTPLHYACSSGDPEIVAWLLRYGASTYIKANDGSSVLHACAD
IRIEQSIWNLQARESLWLRRPSVDPLRPLVGNDYVREPWYQARYSTPEVDVQRNTSPGVV
TIIKMLVEHGVDLGWLDDRKRTALDVALYTGCSDFAEVFSEDEELLNLATVELEKENDGD
KVEEMRRGIKLQMLLMCPRSCWDTLRQYEQGFKSLMDSPQTFLGLLSVRDAAKLMDQCVE
TAPLAMGTYELLEKMMRPSNCQTINHLSVIEHAPGLVKFYSNYENAKAKLEKETLEESWH
PKSLMTALGLACSQEESNILTLRLLVETLKVDVNAKFAVSTGDGYDKRSGVTSGGTALHV
LAEANHHWQLGGLRYLIDNGANVNALDKDGQTPLHVAAGGLVHENRDVKGLARLQAVKIL
LDNGADINALDNHKLTPLHKASNAPDVTKELLSRGADATIGKESPLFEAIFDQNQEVLEA
LLNHGSSPDTLSEAKHSRSVHYNLTKSRRVYPVLCAAFAEKLNSQVANTVPLLRTLIGHG
ANLYLPLNDDETLVHFLFVYPDYEVINELLKQPCASQIDFNHRDQRGQTVLMAACNWRET
LPGFSHRHWEKLPAGPPVRMLDLGADATLVDNLGKTALHHLLSNPGLPDDTLIEFINRTE
VAPTLFQRDQEGYSPLHYALRLLRPQVCEELLTKGADLLQPDPQGRTALHYIASQCLLNT
REPGSPGRLNIELGGDYFNQCHALWKKFIVQGGSINGPENAGNTPLHTYLSSPTNNGYNT
HPESCHTDHYAILFPEDTGVDIFALNKSGEGALHMIAGRVNTYSTVDGHDKKLFVLMMNK
GLDPLKEDERGRSALDIASACKKDDIVGLLGRK
NT seq 6222 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaatctgcgaataccgcagacgaatacgatttcgttgatcatcaagacactgca
ctgagccccgagagcgttgctgagctgagagaatggctccagcctaccgactacctcgcc
gaaagctcagagtatcgtcgtcatctgttatcgcaggctccagggacaggactctggata
tgcgaaacagaagagtatcgcaaatggcatgattctcccgatcatggcagtctctggatc
aaaggtgtgcctggcgcgggcaagtctgtaatgacagccagtttgattcagcatctgcga
acgactgagaattgtcccgttctattcttcttcttccgaaacatcgtcgctgcgaatttc
tcaccacgtgccctgatccaagattggcttgctcaactacttcctcattctcccaagctg
cagtttgctcttcaatcgcgactccaggacagcttagatgacacctcagacaatgagctc
attcaactcttcattgatggtgtaacatgtgtccccaagctgtactgtgttggcgatgct
ctcgatgagatgtcgaccgacagcacgccaatcttggagaggctcaacggtcttgctact
catcggcccagaacattgaagttgctcatgaccagcagaccgtctcggaccttgcagagc
acgctacgagattcatccatcgttcacgtcagcctgcagcagcgccttgtggatgtcgac
atccattcatatctcaatcatcgatttgacaatgcgcctacattggagcatcatcgtgag
gcgaaaaaggatctcatcaacatggttgccgagaaatcagaaggcctgttcctctacgcc
aagctgaccatggaccaagttgaagaatcccttcaaaccgatgcagctctcaacattaaa
gatctcgaggcatcacttccggtaggtctggagcagacgtacacgagcatgctggccaag
caacggggagagcctggagttactacagatgttcaagtcttgatccttgaagcagtaatt
catgcatcgcgtcccctccgattgaatgaacttgcgagcctcttaaagtgcgttcgccct
gacaccacccagcccagcgccttcaaaagtttgatcgcaactagctgtgggccactgatc
gagatcctcgaggacgagactttgcaggtaatccatcactctttcacggaattcctacgt
ggagatactcgcagcgcttccactgttggtgcatctgacttcccaatcatcgactctctt
caggcacacaagcatatggccatgaactgccttgtttatctgcagtccggatcactgcta
ctggagagcgaacaatccaacaactcaactgtcgacccgtcggtgacattcgaaacaccc
agacacaaaatcgatcatgatgcgtggcattacaggcatgagcacctcggtctccgcgac
gaacatgatgctttcgagtacagaccagctcgcctacgacatcaattcctcagctatgcg
gttgagaattggccataccatgcttcgaactacgacgtggatgatgacgaattcttcaag
accatcatggactttctcaactctaacagcctttcgtttcttcgatggcttgtcctgcaa
tggggatcaacatcaagcgataaagggtcactgaaagggatacctacgggtcttcacctt
gcagcctttgcagggctaactcatttcgcctcccagctactcaaacaaggcgtgtcagtc
tcggcagttgatgctcaagagcgggttccattacattgggcagcagctaatggccaccat
aaagtcgccgcgctcctcattcaatacggggccaatcccgatgccgaagacggaagagga
ctgaaacccatccatctcgcaaccttgaagaattacgctaaggttatgaccgtcttactc
gaagcaggtgttaaaccaaacacgataaaaacaagggaaaaccgaacagggcgtctccta
ggcggcgaaagaatcaccaaaggtgaatgctccatatactatgccagtcgaggaggacac
acagaggcaattactgtcatgatacccttctgcgagccacagatgctggagcaacttctg
tgccaatgctgccagttcggtcgagcagatgcagttcaagcaatcttgaacaactcgcct
gtctcgcccaatgcaacttacgaaggggcgacagcattgtattttgcttgtgccatgccc
gatgtcaagtgtgtcgaagctctcattcgtgcaggtgcagatgtgaacaagacatcccaa
tggcaaccgagacgacggatgaatggcccacgtccccagaaacgggaagatgcaacaccg
ctacaccaccttgtagaagcctgggaagataagaatgattccgatagccaagaggtccta
agaatgttgctgaaagctggcgctgaccttgaacggtttgatggccatggaaggactcct
ttgatcatttcagcacaagacccacgatattccaacgaaactcgaaatcatttaccggcc
ctgagggccttggtaagagcgggcgccaacgtcaaggtccttggccagcctccgagtaca
gatacgatgctgcaccaagttcttgaacacagccgggacttagaagtggttaagcttctt
gtggaatatgggtgcgatccgatgcagaaaaacgagaatggagaaactgctctgaagaga
gctgtatctcacacgagttcctacaagccagaatgcgactccagaaagatggatattgtg
aagtacctgctggaccaaggtgcggacccctgttgtaaggataagtacggaagaacgcca
gtcggcgccgcgatgtcacatgggcctgatctattcaaagttctgttcgagaggtccacc
gacacgtccgtaaggcaacactgttggttcaatctttcaagcataagtgatgtaggcaag
ttcactcactatctcgaacttctactttccgaggggatcgacatggagatggtggactca
gatggcaagactctgtatttgaattgtcttggatacggtaaagaacgactgctcattctg
aaagatcacggtgcacggacagatgtcagagactccaacgggaataatgcattgcatcgt
ctctgcttctatgaaaacaggcgtacagaggaaatgaaaatgcttatagacgatggaatc
gatccgcttgccatcaataacaacggggatacgcttttgcaccttgttgcaaagaggtac
gacggtacgagagaaactgccgaccttcttggttggctcctcagttttggtattccagtc
aacgctgttaacaatcatggtgccactcctttacacgtgttccaaacacgcagacgtaca
gggagtaccttgctcgacaacaaacgcactcacttcttggatgtcctcaacaggaccggc
gaggtcgacccgcagatccgcgataatgatggactgtcaccgcttcatctagcagtcatg
agatcagaagttgaaatgtccgaactcaagaaacttgggctagatttgaactttttgact
tctgacctgcaaaacgtccttcatctggcatgccgagctcgcaaagccagcctcgttgcc
cagatcctggaaacagttcccaatatagacatgaaccaggaagaccaatttggcagaaca
ccactccattatgcctgcagttctggcgaccccgagattgttgcctggcttttacgctac
ggcgcttcgacctacatcaaggcaaacgatggttcttctgtcttgcatgcttgtgcggat
atcagaattgagcagagcatatggaaccttcaagcacgagagtctctatggcttcgaaga
ccaagcgttgacccacttcggcctcttgttggtaacgattatgtaagagagccttggtat
caggccagatactctactcctgaagttgatgttcagagaaatacgtcgccaggagttgtt
accatcattaaaatgctagttgagcatggtgttgacctcggctggttagatgatcgcaaa
cgaacagctctggatgtggctctctacacaggatgctctgactttgcggaagtcttttct
gaggatgaagaacttcttaacctggctacagtcgagctggaaaaggaaaatgacggcgac
aaagtggaagaaatgcggaggggcatcaagttacaaatgcttctgatgtgcccgagatct
tgctgggataccttacgccaatacgaacaggggttcaagagtctcatggacagtcctcaa
accttcctcggtctcctttccgtccgtgatgctgcgaaactgatggaccaatgcgttgaa
actgcgccattggcaatgggaacatacgagttactcgagaaaatgatgagaccgagtaac
tgccaaactatcaatcatctctctgtcatcgagcatgcaccggggcttgtcaagttctac
agcaattacgagaacgccaaggcaaagcttgagaaggagaccctcgaggagagttggcac
ccaaaatcccttatgactgcgctcggcctggcatgctcccaagaagagtcaaacattctt
acgttgagattactcgttgagacattgaaggttgacgtcaacgctaaatttgcagtgtca
actggtgatgggtacgacaaacgcagtggcgtcacctccggtgggacggctctgcatgtc
cttgccgaggcaaatcatcactggcagttgggaggcttgagatatctgattgacaatgga
gccaacgtcaatgccctggacaaagatggacaaacaccacttcatgttgcagctggaggg
ttggtccatgagaaccgcgatgtgaaaggtctagcgaggctacaagctgtgaagatactc
cttgacaatggagctgacatcaacgcccttgacaaccacaaactgactcccctacataag
gcatcgaatgcaccagatgtcacaaaagaactgctcagtcgaggtgcagacgcaaccata
ggaaaggaaagccctttattcgaagcaattttcgaccagaaccaggaagtattggaagca
ctcctcaaccatgggtcgagccccgacacactgagcgaagcgaaacatagtagaagcgtg
cattacaacctgactaagtcacgccgcgtctatcctgttctttgcgctgccttcgctgaa
aagctcaattcgcaagttgccaacacagtgcctttgctacgcactctcattgggcatgga
gcaaatctctatctacctctgaacgatgatgagacattggtccattttctctttgtgtac
ccagactatgaagttatcaatgagcttctgaagcagccttgcgcgtcacaaatcgacttc
aaccatcgcgaccaacggggccagactgttcttatggctgcttgtaattggcgggagact
ttacctgggttctctcatagacattgggaaaagctcccggcaggacctcctgtgcggatg
ctggatcttggagccgatgcaaccctcgttgacaatcttggcaagacagcgctccatcat
ctgctgagtaaccctggcttacctgatgatacactcattgagttcataaatcgaacagag
gtcgccccaaccctctttcagagagatcaggaaggatactcaccacttcactatgctctc
cgactattgcgccctcaagtctgtgaagagcttctcacgaagggagctgacctgcttcag
cccgatccacaaggccgcacagctcttcactacatagcctcgcaatgccttctcaatacc
cgagaacctggatccccaggtcgactgaatatcgagcttggtggcgactatttcaatcag
tgccatgctctgtggaaaaagttcattgtccaaggaggttccatcaacggtcccgaaaat
gctggaaacacgcctctgcacacatacctctcttcaccaacaaataacggttataacact
cacccagaatcatgtcatactgaccactacgcaattctgttcccggaagataccggcgtg
gatatttttgcgctgaacaaatcaggagagggagcgcttcacatgattgcagggagagtg
aatacctatagcacggttgatggacatgacaagaaattgtttgttttgatgatgaataaa
ggtttagatccactgaaggaggatgagaggggaagaagcgcgttggatattgcgagtgct
tgtaagaaggatgatattgttggcttacttgggaggaagtga

DBGET integrated database retrieval system