KEGG   Fusarium oxysporum: FOXG_04584Help
Entry
FOXG_04584        CDS       T04882                                 

Definition
(RefSeq) hypothetical protein
Organism
fox  Fusarium oxysporum
SSDB OrthologParalogGFIT
Motif
Pfam: CBM_4_9 SWI-SNF_Ssr4
Motif
Other DBs
NCBI-GeneID: 28946621
NCBI-ProteinID: XP_018239361
UniProt: A0A0D2XKW0
Position
4
AA seq 325 aa AA seqDB search
MRVTTTFGSLILGVGLCAARACVPHPRPTTTSSFSSEIGTTTAGGSATTTTFQETLSITE
SESSIESSVTIETSTANSATTELETTTSGLTSQETLSVAESQTSVESSATTTDGVSSFTT
NLATTTAVTSQETETSTTADEATSTTVEATTTTAGPPEITNLVENGGFEDSTIDPWVVEG
ASPAVFSSQFFCAEGSKCLQLPGNLDNSARVCQRVAVEAGFEYTFKAQVSQNCIKEYGSN
ILTCDDNINTAKLSIDGAFDSGEGGIVGYNTYKDFTYTFSYVDPSIDSTDLCITITQNQG
LSPVFYLDGVSFTRGEAVPIPDPTE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcactactacctttggttccctaatcttgggcgtgggcctctgcgccgctcgc
gcttgtgtcccccatcctcggccgacaacaacatcgtcgttcagcagcgaaattggcact
acaacggctggaggctcggccacaacgacgactttccaagaaactctaagcatcactgag
tccgagtcaagcattgagtcatctgttaccatagaaacctctacagccaactctgccact
acagaactggagacgactacttctggcttaacctctcaagagactttgagtgtcgctgag
tctcagaccagtgttgaatcttctgccactacgaccgatggtgtcagctcttttactacc
aacctcgcgactacgactgctgtcacttcccaagagaccgagacctctacaaccgccgac
gaagccacaagcacaacagtcgaagccacaacgactacagctggccctcccgagattact
aacctcgtcgagaatggtggtttcgaagactctaccatcgatccttgggtggtagaagga
gcctctccggcagtcttcagtagccagtttttctgcgccgagggtagcaagtgtctgcaa
ttgcctggaaaccttgacaattccgccagggtctgccagcgcgtcgcagttgaggcgggc
ttcgagtacactttcaaagcgcaggttagccagaactgtatcaaagagtacggttcaaac
atacttacctgcgatgataatattaataccgctaaactgtccattgatggggcattcgac
tctggtgaaggtggcattgtcgggtataatacctacaaagactttacttataccttctca
tatgtcgacccaagcattgactctactgatctttgcattactatcacgcagaaccaaggc
cttagccccgtcttttaccttgatggcgtttctttcacacgtggggaagctgtgcctatt
cctgacccgacggagtaa

DBGET integrated database retrieval system