KEGG   Fusarium oxysporum: FOXG_07595Help
Entry
FOXG_07595        CDS       T04882                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
fox  Fusarium oxysporum
Pathway
fox00450  Selenocompound metabolism
fox00970  Aminoacyl-tRNA biosynthesis
fox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    FOXG_07595
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FOXG_07595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fox01007]
    FOXG_07595
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fox03016]
    FOXG_07595
Enzymes [BR:fox01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     FOXG_07595
Amino acid related enzymes [BR:fox01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   FOXG_07595
Transfer RNA biogenesis [BR:fox03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    FOXG_07595
 Prokaryotic type
   Other AARSs
    FOXG_07595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e zf-C2H2_2
Motif
Other DBs
NCBI-GeneID: 28949274
NCBI-ProteinID: XP_018243302
UniProt: A0A0J9WMB8
Position
4
AA seq 669 aa AA seqDB search
MRAFRFQSLHGLRQLKSRLAFQSHLSRLGCRAYAPTSQWRRSNSTESTGKEKPFYVTTPI
FYVNAAPHIGHLYTMVLADVIKRWKQISGHEAYLATGTDEHGMKIQQAALKEGLPPKEFC
DNNSNKFKDLAEHANISHDFFIRTTDQEHKDVVQQFWLLLKARAPEGLGLYKGKHEGWYC
VSDECFYPEDLVQSSVSPQTGRKIMVSTESGNEVEWVSEDTWFFPLSKYKEKLLQFYDEN
PTWIQPAHRMNEVRNWVQDHLEDLSITRPATRLNWGIKDPEDPNNTIYVWVDALVNYLTT
SGFGTKWQVGDKDTGIWPADMHIVGKDIIRFHAIYWPALLMAAGLPLPKQILCHNHWTMS
NRKMSKSIGNVVNPFFAVQRWSLDALRYFLVRNGSYKGDMDYANESIAAIYEKDLQANIG
NLFNRISRVRNNKWSTIEAVELAKAGKFENLKEILPTTSPGPDFLSLENSLQCLPEEIRT
NMDNNQVNHALRCIFSLLQDTNRFISETAPWKIVKETKSDENAQTRLNWVIYRSAEALRI
AGIFLQPVMPEKATQLLDGLGVKPERRTVEYARADADLDYGTGPALVSRQPDAFGSMFPP
VAGIELPDAEVVAGMEGPKNRLGRVVAALAKEAQKALEAEKTQEVETKEPKTKEAETKEA
ETKEPETKE
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgagggccttcaggtttcaatcgttacacggcctacgccaattaaaatctagattggcc
tttcaatcccacttgagtcgcctaggatgtcgagcctatgcgccaacctcacaatggcgc
cgttcgaatagcactgagtcgacaggcaaagagaagccattttatgtgacaacgccgatc
ttttatgtcaatgctgctcctcatatcggccatctgtacaccatggttctggcagatgtc
attaaacgatggaagcaaatcagcggccatgaggcctacctggctacaggcactgacgaa
catggcatgaagatccaacaagcagctctgaaagaaggattgccaccgaaggaattctgc
gacaacaactccaacaagttcaaagacctcgccgaacatgccaacatctcgcacgatttc
tttatccgaaccaccgatcaagaacataaagatgttgtacagcagttttggcttcttctc
aaggctcgcgcacctgagggattgggtctgtacaagggaaagcatgagggatggtactgt
gtcagtgatgagtgcttctatcctgaagatcttgtccagtcaagcgtttctcctcaaaca
gggcgcaagatcatggtcagcacagagtcaggcaatgaggttgaatgggtttcggaagat
acgtggtttttcccgttgtccaagtataaggagaaattgcttcagttctatgacgagaac
ccgacatggattcaaccagctcatcgtatgaatgaagtgcgcaactgggttcaagatcat
cttgaggatctctccatcactcgccctgcaacaagactgaactggggaatcaaggatccc
gaagatcccaacaacactatctacgtttgggtggacgctcttgttaattatctaaccaca
tctgggttcggcacaaagtggcaggttggtgataaggacacgggaatctggccagcagac
atgcacatcgtcggcaaagacatcattcgattccacgcgatctactggcctgctcttctc
atggccgcaggtcttcccctacctaagcagatcctctgccacaaccactggaccatgtcg
aaccgcaaaatgtcaaaatccatcggcaatgtcgtcaaccctttcttcgccgttcagcgc
tggagtctcgacgctttgcgatacttcctcgtgcgaaatggcagttacaagggcgacatg
gactacgcgaacgaatctatcgctgctatctacgagaaggaccttcaggccaacattggt
aacctgttcaaccgaatttctcgtgtcaggaataataaatggagtacgattgaggcagtt
gaacttgcgaaggccgggaagtttgagaacctcaaagagatcttgcctacgacttctcct
gggcccgactttttaagtctcgagaacagtctgcagtgcctaccggaggaaattcgaacc
aacatggataacaatcaagtgaaccatgccctgcggtgtatcttttcgcttctccaggac
accaaccgctttatttcagaaactgcgccctggaagattgtgaaagagacgaagtcggat
gaaaatgcgcaaacccggctcaattgggttatttaccgatcagccgaagctctgcgcatt
gcaggcatctttctgcaacctgtcatgcccgaaaaggctacccagctactcgatggtcta
ggtgtcaagccagagcgacgtaccgtcgagtatgctcgcgctgacgctgatctcgattat
ggcacaggacctgctcttgtgagtagacaacctgatgcctttgggtctatgttccctcct
gtcgcgggcattgagctgcctgatgctgaagttgtggctgggatggaagggccaaagaat
cgactgggtcgtgtggtggcagcgttggcgaaggaggctcaaaaggctctagaggctgaa
aagacccaagaggttgagaccaaagagcctaagactaaggaagccgagactaaggaggcc
gaaaccaaagagcctgagactaaagaatga

DBGET integrated database retrieval system