KEGG   Fusarium oxysporum: FOXG_09175Help
Entry
FOXG_09175        CDS       T04882                                 

Definition
(RefSeq) adenosinetriphosphatase
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
fox  Fusarium oxysporum
Pathway
fox03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:fox00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    FOXG_09175
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:fox03041]
    FOXG_09175
Enzymes [BR:fox01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     FOXG_09175
Spliceosome [BR:fox03041]
 Complex C
  Other components
   Step II factors
    FOXG_09175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_30 T2SSE AAA_14 DUF2075 AAA_19 ABC_tran Sigma54_activ_2 SRP54
Motif
Other DBs
NCBI-GeneID: 28950755
NCBI-ProteinID: XP_018246240
UniProt: A0A0D2XYV3
Position
9
AA seq 1197 aa AA seqDB search
MDDLSNLELLSLVSKVSSELKNHMNLEDKTVAEFLIDKRTKCSNFEDFRDDLAKALPSIP
LSLIESIDRLVLALHPQFKGKKANHEEHHSRTLEEKEKVFSGLALPDKEPARDDGSGAFD
DTLALLEGLEGKAKKEKSTRKRSRSPREADYKESRRRKRSRSRERRKRDKYRSRSRSHER
GDEDWRDGYRDSRKDRRGRRRHDDDDDRFRNAPAPEVDDSPQLHKVYEGHVTGLKEFGAF
INLHNVRGRVDGLVHVSRMSAGQRVNHPSDLVSHGQKVWVKVTSLDKDQNGRDRVGLSMK
DVDQSTGEDLEPQARMTTGANMEALGGGGGGLRDGFAEPTGMPRDSLGPPRRQKKRMTSP
ERWEIRQLIASGVAKASDYPDLEEDYNATLRGDGELELEEDVDIEVREEEPPFLAGQTKQ
SLELSPIRVVKAPEGSMNRAAMSGTALAKERKELKQQEADAAAKDEPKENLSSQWQDPMA
DPDKRKFASDLRNARKNQPSEDVPEWKKAVIPKGQSLGKRTNLSIKEQRESLPVYAFREQ
LIKAVYENQILIVVGETGSGKTTQLTQYLAEAGFANDGIIGCTQPRRVAAMSVAKRVAEE
VGCKLGEEVGYTIRFEDCTSPSTKIKYMTDGMLQREILVDPDMSRYSCIMLDEAHERTIA
TDVLFALLKKALKRRPDMKVIVTSATLDADKFSAYFNECPIFTIPGRTYPVEILYSKEPE
SDYLDTALVTVMQIHITEPKGDILLFLTGQEEIDTACEVLYERMKALGPNVPDLIILPVY
ASLPTEMQSRIFDPAPPGSRKVVIATNIAETSITIDEIYYVVDPGFVKQNAYDPKLGMDS
LVVTPISQAQANQRAGRAGRTGPGKCFRLYTEAAYQSEMLPTSIPEIQRQNLSTTILMLK
AMGINDLLHFDFMDPPPINTMLTALEELYALSALDDEGLLTRLGRKMADFPMEPSLAKVL
IAAVDLECADEVLSIVSMLNIPTVFYRPKEKQSQADQKKAKFHDPHGDHLTFLNVYNSWK
QSGYSAPWCFENFIQARSMRRAKDVRDQIVKIMDRYKHSIKSCGRDTEKVRRALCAGFFR
NAARKDPQEGYKTLIEGTPVYLHPSSALFGKQAEWVIYHELILTSKEYMHCTTSIEPKWL
VEAAPTFFKVAPTDKLSKRKKAERIQPLYNKFATEDDWRLSAQRKGGRGGGGGGTWG
NT seq 3594 nt NT seq  +upstreamnt  +downstreamnt
atggacgacttatcgaatcttgagctgctgtccctcgtctcgaaggtgtcctcagagttg
aagaatcatatgaacttagaggacaagactgtcgctgaatttctcatcgataaacgaacc
aaatgcagcaacttcgaggatttccgcgatgatctagcaaaggctctcccctcgattcct
ctcagtctcatcgagagtatcgatcgtttggtgcttgctctacacccacagtttaaaggt
aaaaaggccaaccacgaagagcaccattcgaggaccctagaagagaaggaaaaggtcttc
agtgggctcgcactgccggataaggagcctgcgcgtgacgatggatcgggcgcattcgac
gacacactggcgctgttagaaggtctagaggggaaggcgaaaaaagagaagtccacgaga
aaacgaagtcgaagcccccgcgaggctgattacaaagagtcaaggaggagaaaaaggtcg
cgctcgagagaacgacgaaaacgagataaatatcgatcgcggtcacggtcgcatgagcga
ggcgacgaagattggcgtgatgggtaccgcgattcgcgcaaagatcgacgagggcgtcgg
cgacacgacgacgacgacgaccgatttcgcaatgctccagctcctgaggttgatgattcg
ccgcagctgcacaaggtctacgagggacatgttacaggcctcaaagagttcggtgccttc
atcaatttgcacaatgtaagaggcagagtcgatggcctcgtacacgtttcgcgaatgtct
gctggacagcgcgtcaaccacccgtcggatttggtgtcgcatggacaaaaggtctgggtc
aaggtgacaagtctcgataaggatcagaatggccgcgatcgtgtgggcttgtcaatgaaa
gatgttgatcagtcgactggggaggacctagaaccacaagctcgaatgacaactggtgcc
aatatggaagctttgggaggaggaggaggtggtctaagggacgggtttgcggaaccaacc
ggcatgcctcgagatagcttgggccctccacgacgacagaagaagagaatgacttctccc
gaaaggtgggagattagacaattgatcgcatcgggagtggccaaggcttcggattaccct
gacctggaagaagactacaacgcgactctccgcggagatggcgagcttgagcttgaagag
gatgtcgatattgaggttcgtgaggaggaaccaccgttcttggccggccagaccaagcag
tcccttgaattatcacctatccgcgttgtcaaggccccagaaggctctatgaatcgagca
gctatgtctggtactgccttggcaaaggaacgcaaagaactcaagcaacaagaagccgat
gcagctgcgaaggacgaacccaaagagaacctatcctctcaatggcaagatcctatggct
gatcccgataagaggaagtttgctagcgatttgaggaatgccaggaagaatcagccttcc
gaagacgttcccgaatggaagaaggcagtcattccaaagggacagtctctgggcaagcgc
accaatttgagtatcaaggaacagcgagagtcgcttcctgtatatgcattccgagagcaa
ctgatcaaggctgtttacgaaaaccagatcttgattgtagtcggagaaacaggatcagga
aagacgactcagttaacacaatacctcgctgaagctggctttgccaatgatggtatcatt
ggctgtacgcaacctcgtcgtgtggctgccatgtccgtcgccaagcgagtagcggaagaa
gtgggctgtaagcttggtgaagaggtcggatatacgattcgattcgaagactgcactagt
ccttcgacgaagatcaagtacatgactgatggtatgcttcaacgtgagattctggtagat
cccgatatgtcgcgatactcctgtatcatgcttgatgaagctcacgaacgtaccattgcc
actgatgtgctgtttgccctgctaaagaaggctctcaagcgacgccccgatatgaaagtc
attgtcacttcagctactctcgatgcagataaattttctgcgtatttcaacgaatgtccc
attttcaccattccaggtcgaacgtaccctgtcgaaatcctctactcgaaggaacccgag
tccgattacctggacactgctcttgtcacagtcatgcagatccatattaccgagcccaag
ggcgacattcttcttttcttaacaggccaagaagaaattgacacggcatgcgaagtcttg
tatgagagaatgaaagctttagggcctaatgtgccagaccttatcattcttcccgtctat
gcttcacttccgacggaaatgcaaagtcgaatcttcgatcctgcaccccctggcagccgt
aaggttgtcatcgccaccaatattgcagagacttccattaccatcgacgagatttactat
gtcgttgacccgggcttcgtgaagcagaacgcttacgaccccaagttgggtatggactct
ctcgtcgtcacaccaatttctcaggcccaggcaaaccaaagagctggacgagccggacga
actggacccggaaagtgtttccgtttatacaccgaggcagcttaccagtctgaaatgttg
ccgactagtatccccgaaatccaacgacagaacttgtccacaacaatcctcatgctcaag
gcaatgggcattaacgacttgcttcactttgacttcatggacccgccccctatcaacacc
atgcttacagcactggaggagctatatgccctcagcgccctcgacgatgaaggtctactt
actcgactggggcgaaagatggctgatttccctatggaaccttctcttgccaaggtgctt
atcgctgccgttgatctagaatgtgcagacgaagtcctcagcatcgtgtccatgcttaac
attcccactgtcttttaccgccccaaagagaagcagtctcaagcagaccaaaagaaggcc
aagttccacgatccccacggcgatcacctaaccttcctcaacgtctacaactcgtggaag
cagagcggctactcagcaccctggtgtttcgagaacttcatccaagcgcgttccatgcgt
cgcgcaaaggacgtccgcgaccagatcgtcaagatcatggaccgctacaaacactccatc
aagtcctgcggccgcgacaccgaaaaggtccgcagggccctctgcgcaggcttcttccgc
aacgcagcccgcaaagatccccaggaaggttacaagacccttatcgagggcacccccgtg
tatctgcacccgagctccgcgctcttcggcaaacaggccgagtgggtcatctaccacgaa
ctcatcctcacgagcaaggagtacatgcactgcaccacgagcatcgagcccaagtggctt
gtcgaagccgccccgaccttcttcaaggttgcgccgacggataagctgagcaagaggaag
aaggcggagaggatccagccgctgtataataaatttgctacggaggacgattggaggttg
agtgcgcaaaggaagggcggaagaggaggtggcggtggtggaacctggggttaa

DBGET integrated database retrieval system