KEGG   Fusarium oxysporum: FOXG_09643Help
Entry
FOXG_09643        CDS       T04882                                 

Definition
(RefSeq) endoglucanase type B
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
fox  Fusarium oxysporum
Pathway
fox00500  Starch and sucrose metabolism
fox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FOXG_09643
Enzymes [BR:fox01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     FOXG_09643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_6 CBM_1 MGC-24
Motif
Other DBs
NCBI-GeneID: 28951183
NCBI-ProteinID: XP_018247005
UniProt: A0A0C4DHV2
Position
11
AA seq 462 aa AA seqDB search
MAYKLILAAFAATALAAPVEERQSCSNGVWAQCGGQNWSGTPCCTSGNKCVKLNDFYSQC
QPGTAEPSSTAAGPSSTTATKTTATGGSSTTAGGSVTSAPPAASGNPYSGVDLWANSYYR
SEVMNLAVPKLSGAKATAAAKVADVPSFQWMDTYDHISLMEDTLADIRKANKAGGKYAGQ
FVVYDLPNRDCAAAASNGEYSLDKDGANKYKAYIAKIKGILQDYSDTKVILVIEPDSLAN
LVTNLNVDKCAKAESAYKELTVYAIKELNLPNVSMYLDAGHGGWLGWPANIGPAAKLYAQ
IYKDAGKPSRVRGLVTNVANYNGWKLSTKPDYTESNPNYDEQRYINAFAPLLAQEGWSNV
KFIVDQGRSGKQPTGQKAQGDWCNAKGTGFGLRPSTNTGDALADAFVWVKPGGESDGTSD
TSAARYDYHCGLDDALKPAPEAGTWFQAYFEQLLDNANPSFL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcctataagcttatcctcgccgcctttgcggctacagctcttgctgctcctgttgaa
gagcgccagtcctgcagcaacggagtttgggctcagtgtggtggccagaactggagcggc
actccttgctgcaccagcggaaacaagtgtgtcaagctcaacgacttctactcccagtgc
cagcccggcactgctgagccttcttcgactgctgctggacccagctccaccactgccacc
aagaccaccgccacgggtggaagctctactactgctggaggctctgtcacttctgcccct
cctgcggccagtggcaacccatactctggtgttgatctctgggccaacagctactaccgc
tctgaggttatgaacttggctgttcctaagctgagcggtgccaaggctactgctgccgcc
aaggtcgctgatgttccctccttccagtggatggacacctacgaccacatttctctcatg
gaggatacccttgctgatatccgcaaggctaacaaggctggtggcaagtatgctggtcag
ttcgttgtctacgatcttcccaaccgtgactgcgctgctgctgcctccaatggagagtac
tccctcgacaaggacggtgccaacaagtacaaggcctacatcgccaagatcaagggcatc
ctccaggactactccgacaccaaggtcatccttgtcattgagcctgactctcttgctaac
ctggtcaccaacctgaacgtcgacaagtgtgccaaggccgagagtgcttacaaggagctc
accgtttacgctatcaaggaactcaacctccccaacgtctccatgtacctcgatgccggt
cacggtggctggctcggctggcccgccaacattggccctgctgctaagctctacgcccag
atctacaaggacgctggcaagccttctcgcgttcgcggtctcgtcaccaacgtcgccaac
tacaacggctggaagctctccaccaagcccgactacaccgagagcaaccccaactacgat
gagcagcgatacatcaacgccttcgctcctcttctcgctcaggagggctggtccaatgtc
aagtttatcgtcgaccagggccgatctggtaagcagcctactggtcagaaggctcagggc
gattggtgcaacgccaagggtactggtttcggacttcgaccttccaccaacactggtgat
gctctcgccgacgctttcgtctgggtcaagcctggtggtgagtctgatggtacctctgat
acctctgctgctcgctatgactaccactgtggtctcgatgatgctctcaagcccgctcct
gaggccggaacctggttccaggcttacttcgagcagctcctcgacaacgccaacccctca
tttctgtaa

DBGET integrated database retrieval system